Property Summary

NCBI Gene PubMed Count 131
PubMed Score 407.39
PubTator Score 192.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
hepatocellular carcinoma 1.200 1.8e-05
pancreatic cancer 1.500 1.6e-03
psoriasis 1.100 5.6e-04
osteosarcoma -1.405 1.8e-04
medulloblastoma, large-cell -1.800 1.0e-05
pancreatic ductal adenocarcinoma liver m... -1.999 7.9e-04
tuberculosis and treatment for 6 months -1.500 6.5e-03
pancreatic carcinoma 1.500 1.6e-03
ovarian cancer -2.000 3.9e-14

Protein-protein Interaction (11)

Gene RIF (113)

PMID Text
26787880 data illustrate a lipid G-protein coupled receptor (GPCR)-IFNAR1 regulatory loop that balances effective and detrimental immune responses and elevated endogenous S1PR1 signaling
26679999 Data suggest IFNA2 (interferon, alpha 2) binding to extracellular domain of IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation/affinity of binding rather than specific conformational changes.
26679744 rs2843710 of IFNAR1 was associated with the susceptibility and severity of EV71 HFMD in Chinese Han populations.
26676772 These findings suggest that influenza A virus hemagglutinin causes IFNAR1 degradation, which in turn helps the virus escape the powerful innate immune system.
26159719 Prolidase was required for IFNAR1 maturation and accumulation, activation of IFNbeta-stimulated gene induction, and IFN-I-dependent viral control.
26008745 Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18.
25939635 Genetic polymorphisms of the promoter of INFAR gene represent important factors associated with the clinical phase of HBeAg-negative chronic HBV infection.
25675103 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients
25501140 sequence variants of both the IFNAR1-17470 and IL-10-592 genes were correlated with susceptibility to chronic hepatitis B.
25445652 Results show that SNPs in IFNAR1 and IFNG were risk factors for malaria in Indian population.
25265476 The expression of IFNAR1, IFNgammaR1 and ribovarin transporters were significantly impaired in chronic liver disease and cirrhotic livers.
25072284 A small proportion of both pancreatic and periampullary tumors showed a strong expression of the IFNAR-1.
24704786 The crystal structure of a receptor-binding fragment of human TYK2, encompassing the FERM and SH2 domains, in complex with peptide motif from the interferon-alpha receptor chain 1 (IFNAR1) is presented.
24460759 Therefore, this study associated, for the first time, in a large panel of pancreatic cancer cell lines the effects of IFN-alpha/-beta with the expression of type-I IFN receptors.
24334027 These data indicate that type I IFN, via an action of IFNAR1, mediates pulmonary arterial hypertension.
23663046 Results suggest that oxidative stress play an important role in the regulation of type I interferon receptors IFNAR1 and IFNAR2 in chronic hepatitis B virus (HBV) infection.
23209811 Results identified genetic variants in interferon genes that influence melanoma progression and survival with modulation of effect due to treatment status.
23201923 [review] The type I interferon system has an important role in the pathogenesis of Sjogren's syndrome.
23129613 PTP1B is a specific regulator of IFNAR1 endocytosis.
22824466 common genetic changes in IFNAR1 may influence HCC risk, likely through miR-1231-mediated regulation.
22786773 These new findings reveal distinct and overlapping signaling mechanisms used by B-cell antigen receptor and IFNAR in the regulation of TLR7 tolerance and activation.
22258259 2A protease encoded by EV71 as an antagonist of IFNB1 and the protease activity is required for reducing IFNAR1 levels.
22218495 HBX expression downregulates type I IFN receptor, leading to disturbance of extracellular type I IFN signaling.
22162633 Activation of type I interferon pathway in systemic lupus erythematosus: association with distinct clinical phenotypes.
22156349 IFNalphaR is dispensable on responding CD4+ T cells. Cells derived from transgenic bone marrow are sufficient to restore IFNalphaR-dependent pathways in IFNalphaR-deficient mice.
22136495 Early progenitors and mature megakaryocytes, but not platelets, express functional IFNAR and synthetize/release IFN-beta, revealing not only that megakaryo/thrombopoiesis regulation by IFN-I is associated with a specific interaction with its receptor
22036215 Systemic lupus erythematosus patients are found to have the highest serum type I IFN activity; in contrast, the untreated relapsing-remitting multiple sclerosis population has the lowest levels of endogenous IFN-alpha/beta activity.
21865166 Tyrosine phosphorylation of PKD2 is required for IFNalpha-stimulated activation of this kinase as well as for efficient serine phosphorylation and degradation of IFNAR1 and ensuing restriction of the extent of cellular responses to IFNalpha.
21832278 In cells exposed to VEGF, phosphorylation-dependent degradation of IFNAR1 leads to an inhibition of type 1 IFN signaling and is required for efficient VEGF-stimulated angiogenesis.
21830897 These data demonstrate that West Nile virus infection results in a reduction of IFNAR1 protein through a non-canonical protein degradation pathway, and may participate in the inhibition of the interferon response.
21821707 Bcr-abl signals to desensitize chronic myeloid leukemia cells to IFNalpha via accelerating the degradation of its receptor.
21757742 The consequent effect of SOCS1 inhibition of Tyk2 not only results in a reduced IFN response because of inhibition of Tyk2 kinase-mediated STAT signaling but also negatively impacts IFNAR1 surface expression, which is stabilized by Tyk2.
21756311 The results of this study suggest that expression of cell surface IFNAR1 is critical for the response of hepatitis C virus to exogenous interferon alpha.
21716316 CLC and IFNAR1 were identified to be overall differentially expressed between early- and late-onset CRC, and are important in the development of early-onset CRC.
21695243 activation of p38 kinase in response to pathogen-recognition receptors stimulation results in a series of phosphorylation events within the IFNAR1 chain of the Type I IFN receptor
21690295 A low number of receptors suffices for antiviral response and is thus a robust feature common to all cells. Conversely, a high number of receptors is required for antiproliferative activity, which allows for fine-tuning on a single-cell level.
21540188 an important role of p38 kinase in the ligand-independent stimulation of IFNAR1 ubiquitination and degradation
21173164 Expression and kinase activity of PKD2 are required for the ligand-inducible stimulation of IFNAR1 ubiquitination and endocytosis and for accelerated proteolytic turnover of IFNAR1.
20811626 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20565290 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20378664 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20065083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20020050 The 3a protein was found to induce serine phosphorylation within the IFN alpha-receptor subunit 1 (IFNAR1) degradation motif and to increase IFNAR1 ubiquitination.
19957332 Down-regulation of type I interferon receptor sensitizes bladder cancer cells to vesicular stomatitis virus-induced cell death.
19948722 Both ligand-dependent and -independent pathways converge on phosphorylation of Ser(535) within the IFNAR1 degron leading to recruitment of beta-Trcp E3 ubiquitin ligase and concomitant ubiquitination and degradation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19879773 These results suggest that a combination of serum soluble interferon-alpha/beta receptor and high-sensitivity-CRP thresholds may be more reliable diagnostic parameter for gastrointestinal and hepatobiliary-pancreatic cancer.
19817957 Observational study of gene-disease association. (HuGE Navigator)
19805514 Results suggest a role for mammalian and parasite casein kinase 1alpha in regulating IFNAR1 stability and type I IFN signaling.
19796549 IFNAR1 (interferon-alpha receptor 1) (G/C in SNP18417) and IFNAR1 (interferon-alpha receptor 2) (G/T in SNP 11876) polymorphisms jointly, but not individually, may confer susceptibility to Behcets disease in a Turkish population
19773451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19561067 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19559055 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19501422 Upon HBV infection, decreased binding affinity of HMGB1 to the IFNAR1 promoter -3T variant is aggravated by the suppressed PARP-1 expression caused by HBV, resulting in a further attenuated IFNAR1 expression.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19299650 Defective monocyte responses to IFNalpha/beta may play an important role in the pathogenesis of HIV-1 infection, and decreased IFNalpha/betaR expression may serve as a novel marker of disease progression.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19220955 The expression of interferon-alpha receptor in liver tissues in patients with chronic hepatitis B correlates well with the pathological grading and alanine aminotransferase level.
19124753 CD11c-Cre+/- ifnar1(fl/fl) transgenic mice respond with vigorous IFN-alpha production to mouse hepatitis virus infection, suggesting that lack of IFNAR on plasmacytoid dendritic cells has no significant impact on the early type I IFN response.
19103527 two variants of the IFNAR1 gene are associated with the clinical presentation of hepatitis B virus infection
19103527 Observational study of gene-disease association. (HuGE Navigator)
18953482 Observational study of gene-disease association. (HuGE Navigator)
18937499 Mutation of the IFNAR-1 receptor binding site of human IFN-alpha2 generates type I IFN competitive antagonists.
18801736 the stability of the ternary interferon-receptor complex rather than the affinity to the individual subunits dictates differential biological activities
18761606 In conclusion, IFNAR1 19158C/G polymorphism is primarily associated with susceptibility to chronic HBV infection.
18761606 Observational study of gene-disease association. (HuGE Navigator)
18535656 a major bottleneck was observed during POLIOVIRUS transit to the brain in PVR mice, but was absent in PVR-IFNAR-/- mice, suggesting that the interferon response was a determinant of the peripheral site-to-brain bottleneck
18474601 Tyk2 contributes to both the regulation of total IFNAR1 levels as well as the regulation of the cell surface density of this receptor chain.
18362156 place TRAF2 directly in the signaling pathway transduced through the IFNAR1 subunit of the IFN receptor
18338947 Observational study of gene-disease association. (HuGE Navigator)
18250407 An IFNAR1/retinoic acid-inducible gene I (RIG-I)-dependent pathway mediates SOCS1 and SOCS3 up-regulation in influenza A virus-infected bronchial epithelial cells.
18166147 We discuss the signaling events that might lead to ubiquitination and degradation of IFNAR1 via ligand-dependent and independent pathways and their potential physiologic significance.
18056411 Ubiquitination of IFNAR1 promotes its interaction with the adaptin complex that is required for the robust internalization of IFNAR1, implicating cooperation between site-specific ubiquitination and the linear endocytic motif in regulating this process.
17923090 report that in response to type 1 interferon (IFNalpha), IFNalpha type 1 receptors recruit cytoplasmic CREB-binding protein (CBP).
17823081 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17823081 This study suggests that when combination therapy with high dose IFN-alpha and ribavirin is administered, HCV genotypes and age rather than the IFNAR1 polymorphisms are the predictors of a sustained response.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17667505 The intensity and distribution of IFNAR-1 may predict the response to therapy with IFN-alpha and IFN-beta in pancreatic cancer.
17517919 Data describe the species specificity of IFN-alphas, the residues in murine IFN-alpha4 that preclude strong affinity interactions with human IFNAR1 and 2, and residues in human IFN-alpha8 that resemble a receptor interactive domain in murine IFN-alpha4.
17310065 constructed a phage display library by randomizing three positions on IFNalpha2 previously shown to confer weak binding to IFNAR1
17125879 Observational study of gene-disease association. (HuGE Navigator)
17125879 Polymorphisms of IFNAR1 promoter may affect, at least in part, the outcomes of HBV infection.
17027223 Observational study of gene-disease association. (HuGE Navigator)
17001036 Human type I interferon receptor binding site on human interferon-alpha2 by cross saturation and an NMR-based model of the complex.
16624932 Monocyte-derived dendritic cells can modulate their sensitivity to two IFN subtypes through a differential regulation of the IFNAR subunits.
16338279 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16171819 Data describe the mapping of the complete binding region of IFNAR1 on IFNalpha2 using a panel of 21 single alanine mutant proteins.
15990456 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15990456 The promoter GT repeat dinucleotide microsatellite polymorphism of the IFNAR1 gene may represent a risk factor for the development of depressive symptoms during IFN-alpha therapy for hepatitis C and other conditions.
15946680 analysis of the roles of the four Ig-like sub-domains (SDs) of the extracellular domain of ifnar1 (ifnar1-EC) for ligand recognition and receptor assembling
15885318 Observational study of gene-disease association. (HuGE Navigator)
15589821 The IFNAR1 subunit of the type I IFN receptor complex contains a functional nuclear localization sequence.
15449939 A dynamic model for the IFN-alpha/receptor complex predicts that IFNAR1 and IFNAR2 are probably anchored in close proximity on the cell surface and that upon IFN binding, the complex assumes a closed form, resulting in activation of intracellular kinases.
15337770 phosphorylation and ubiquitin acceptor sites are required for ubiquitination and degradation of IFNAR1
15063762 Observational study of gene-disease association. (HuGE Navigator)
14727154 Observational study of gene-disease association. (HuGE Navigator)
14647450 IFNAR1 and IFNAR2 levels reveal that the KAS-6/1 cell line overexpresses IFNAR1 relative to other myeloma cell lines that are growth arrested by IFN-alpha.
14532120 IFNAR1 interacts with the Homolog of Slimb (HOS) F-box protein in a phosphorylation-dependent manner, and that this interaction is promoted by interferon alpha
12761564 Observational study of gene-disease association. (HuGE Navigator)
12761564 An association has been demonstrated between two IFNAR1 polymorphisms and cerebral malaria.
12697242 Observational study of gene-disease association. (HuGE Navigator)
12620806 Measles virus suppresses interferon-alpha signaling pathway: association of viral accessory proteins, C and V, with interferon-alpha receptor complex
12618863 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12554654 Data show that Tyk2 tyrosine kinase is essential for stable cell surface expression of IFNAR1.
12220192 Only the tyrosine-phosphorylated form of interferon alpha receptor subunit 1 binds to Stat2.
9225992 Seven-day cultured macrophages treated with HIV-1 gp120 exhibit higher levels of type I IFN receptors than that of 1-day cultured monocytes

AA Sequence

MMVVLLGATTLVLVAVAPWVLSAAAGGKNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGM      1 - 70
DNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQIGPPEVHLEAEDK     71 - 140
AIVIHISPGTKDSVMWALDGLSFTYSLVIWKNSSGVEERIENIYSRHKIYKLSPETTYCLKVKAALLTSW    141 - 210
KIGVYSPVHCIKTTVENELPPPENIEVSVQNQNYVLKWDYTYANMTFQVQWLHAFLKRNPGNHLYKWKQI    211 - 280
PDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYI    281 - 350
GAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLNKSSV    351 - 420
FSDAVCEKTKPGNTSKIWLIVGICIALFALPFVIYAAKVFLRCINYVFFPSLKPSSSIDEYFSEQPLKNL    421 - 490
LLSTSEEQIEKCFIIENISTIATVEETNQTDEDHKKYSSQTSQDSGNYSNEDESESKTSEELQQDFV       491 - 557
//

Text Mined References (140)

PMID Year Title
26787880 2016 S1PR1-mediated IFNAR1 degradation modulates plasmacytoid dendritic cell interferon-? autoamplification.
26679999 2016 Type I Interferon Signaling Is Decoupled from Specific Receptor Orientation through Lenient Requirements of the Transmembrane Domain.
26679744 2015 A functional polymorphism in IFNAR1 gene is associated with susceptibility and severity of HFMD with EV71 infection.
26676772 2015 Hemagglutinin of Influenza A Virus Antagonizes Type I Interferon (IFN) Responses by Inducing Degradation of Type I IFN Receptor 1.
26159719 2015 Flavivirus Antagonism of Type I Interferon Signaling Reveals Prolidase as a Regulator of IFNAR1 Surface Expression.
26008745 2015 Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling.
25939635 2015 The interferon receptor-1 promoter polymorphisms affect the outcome of Caucasians with HBeAg-negative chronic HBV infection.
25675103 2015 IFNL4 and IFNL3 associated polymorphisms strongly influence the spontaneous IFN-alpha receptor-1 expression in HCV-infected patients.
25501140 2014 Association of the IFNAR1-17470 and IL-10-592 cytokine variants with susceptibility to chronic hepatitis B viral infections in a Chinese population.
25445652 2015 Interferon-? (IFNG) microsatellite repeat and single nucleotide polymorphism haplotypes of IFN-? receptor (IFNAR1) associated with enhanced malaria susceptibility in Indian populations.
25265476 2014 Impaired expression of type I and type II interferon receptors in HCV-associated chronic liver disease and liver cirrhosis.
25072284 2015 Type I Interferon Receptor Expression in Human Pancreatic and Periampullary Cancer Tissue.
24704786 2014 Structural basis of recognition of interferon-? receptor by tyrosine kinase 2.
24460759 2014 Influence of type-I Interferon receptor expression level on the response to type-I Interferons in human pancreatic cancer cells.
24334027 2014 Evidence for the involvement of type I interferon in pulmonary arterial hypertension.
24075985 2013 A BRISC-SHMT complex deubiquitinates IFNAR1 and regulates interferon responses.
23663046 2013 Peripheral type I interferon receptor correlated with oxidative stress in chronic hepatitis B virus infection.
23209811 2012 Influence of genetic variants in type I interferon genes on melanoma survival and therapy.
23201923 2013 Type I interferons in Sjögren's syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23129613 2012 Protein tyrosine phosphatase 1B is a key regulator of IFNAR1 endocytosis and a target for antiviral therapies.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22824466 2012 A miR-1231 binding site polymorphism in the 3'UTR of IFNAR1 is associated with hepatocellular carcinoma susceptibility.
22786773 2012 Type I IFN receptor and the B cell antigen receptor regulate TLR7 responses via distinct molecular mechanisms.
22258259 2012 Enterovirus 71 disrupts interferon signaling by reducing the level of interferon receptor 1.
22218495 2012 Hepatitis B virus X protein inhibits extracellular IFN-?-mediated signal transduction by downregulation of type I IFN receptor.
22162633 2011 Activation of type I interferon pathway in systemic lupus erythematosus: association with distinct clinical phenotypes.
22156349 2012 Type I IFN-dependent T cell activation is mediated by IFN-dependent dendritic cell OX40 ligand expression and is independent of T cell IFNR expression.
22136495 2011 Expression and functionality of type I interferon receptor in the megakaryocytic lineage.
22036215 2012 Type I interferon signature is high in lupus and neuromyelitis optica but low in multiple sclerosis.
21865166 2011 Tyrosine phosphorylation of protein kinase D2 mediates ligand-inducible elimination of the Type 1 interferon receptor.
21854986 2011 Structural linkage between ligand discrimination and receptor activation by type I interferons.
21832278 2011 Vascular endothelial growth factor-induced elimination of the type 1 interferon receptor is required for efficient angiogenesis.
21830897 2011 West Nile virus infection induces depletion of IFNAR1 protein levels.
21821707 2011 Bcr-abl signals to desensitize chronic myeloid leukemia cells to IFN? via accelerating the degradation of its receptor.
21757742 2011 Suppressor of cytokine signaling (SOCS) 1 inhibits type I interferon (IFN) signaling via the interferon alpha receptor (IFNAR1)-associated tyrosine kinase Tyk2.
21756311 2011 Mechanism of HCV's resistance to IFN-? in cell culture involves expression of functional IFN-? receptor 1.
21716316 2011 CLC and IFNAR1 are differentially expressed and a global immunity score is distinct between early- and late-onset colorectal cancer.
21695243 2011 Pathogen recognition receptor signaling accelerates phosphorylation-dependent degradation of IFNAR1.
21690295 2011 Stochastic receptor expression determines cell fate upon interferon treatment.
21540188 2011 Role of p38 protein kinase in the ligand-independent ubiquitination and down-regulation of the IFNAR1 chain of type I interferon receptor.
21173164 2011 Ligand-stimulated downregulation of the alpha interferon receptor: role of protein kinase D2.
20811626 2010 Genetic variants in inflammation-related genes are associated with radiation-induced toxicity following treatment for non-small cell lung cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20565290 2010 Persistent effect of IFNAR-1 genetic polymorphism on the long-term pathogenesis of chronic HBV infection.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20378664 2010 Analysis of multiple candidate genes in association with phenotypes of multiple sclerosis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20065083 2010 A polymorphism associated with STAT3 expression and response of chronic myeloid leukemia to interferon ?.
20020050 2009 The SARS Coronavirus 3a protein causes endoplasmic reticulum stress and induces ligand-independent downregulation of the type 1 interferon receptor.
19957332 2010 Down-regulation of type I interferon receptor sensitizes bladder cancer cells to vesicular stomatitis virus-induced cell death.
19948722 2010 Inducible priming phosphorylation promotes ligand-independent degradation of the IFNAR1 chain of type I interferon receptor.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19879773 2010 Serum evaluation of soluble interferon-alpha/beta receptor and high-sensitivity C-reactive protein for diagnosis of the patients with gastrointestinal and hepatobiliary-pancreatic cancer.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19805514 2009 Mammalian casein kinase 1alpha and its leishmanial ortholog regulate stability of IFNAR1 and type I interferon signaling.
19796549 IFNAR1 and IFNAR2 polymorphisms in patients with Behçet's disease.
19773451 2009 Role of inflammation gene polymorphisms on pain severity in lung cancer patients.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19561067 2009 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19559055 2009 A pharmacogenetic study of polymorphisms in interferon pathway genes and response to interferon-alpha treatment in chronic hepatitis B patients.
19501422 2009 Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19299650 2009 Desensitization to type I interferon in HIV-1 infection correlates with markers of immune activation and disease progression.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19220955 2009 [Expression of interferon-alpha receptor in liver tissues in patients with chronic hepatitis B and its clinical significance].
19124753 2009 Type I IFN-mediated protection of macrophages and dendritic cells secures control of murine coronavirus infection.
19103527 2008 Association of two variants of the interferon-alpha receptor-1 gene with the presentation of hepatitis B virus infection.
18953482 2008 Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.
18937499 2008 Mutation of the IFNAR-1 receptor binding site of human IFN-alpha2 generates type I IFN competitive antagonists.
18801736 2008 The stability of the ternary interferon-receptor complex rather than the affinity to the individual subunits dictates differential biological activities.
18761606 2009 A non-synonymous single nucleotide polymorphism in IFNAR1 affects susceptibility to chronic hepatitis B virus infection.
18535656 2008 Multiple host barriers restrict poliovirus trafficking in mice.
18474601 2008 Basal ubiquitin-independent internalization of interferon alpha receptor is prevented by Tyk2-mediated masking of a linear endocytic motif.
18362156 2008 The role of TRAF2 binding to the type I interferon receptor in alternative NF kappaB activation and antiviral response.
18338947 2008 Multiple sclerosis and hepatitis C virus infection are associated with single nucleotide polymorphisms in interferon pathway genes.
18250407 2008 Cutting edge: innate immune response triggered by influenza A virus is negatively regulated by SOCS1 and SOCS3 through a RIG-I/IFNAR1-dependent pathway.
18166147 2008 Ligand-independent pathway that controls stability of interferon alpha receptor.
18056411 2007 Site-specific ubiquitination exposes a linear motif to promote interferon-alpha receptor endocytosis.
17923090 2007 Acetylation-dependent signal transduction for type I interferon receptor.
17823081 2007 Polymorphisms in the IFNAR1 gene in patients with chronic hepatitis C: outcome of combined IFN-alpha therapy.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17667505 2007 Type I interferons in the treatment of pancreatic cancer: mechanisms of action and role of related receptors.
17517919 2007 A structural basis for interferon-alpha-receptor interactions.
17310065 2007 An interferon alpha2 mutant optimized by phage display for IFNAR1 binding confers specifically enhanced antitumor activities.
17125879 2007 Polymorphisms of type I interferon receptor 1 promoter and their effects on chronic hepatitis B virus infection.
17027223 2006 Exhaustive genotyping of the interferon alpha receptor 1 (IFNAR1) gene and association of an IFNAR1 protein variant with AIDS progression or susceptibility to HIV-1 infection in a French AIDS cohort.
17001036 2006 Determination of the human type I interferon receptor binding site on human interferon-alpha2 by cross saturation and an NMR-based model of the complex.
16624932 2006 Differential responsiveness to IFN-alpha and IFN-beta of human mature DC through modulation of IFNAR expression.
16338279 2005 Pharmacogenomics of responsiveness to interferon IFN-beta treatment in multiple sclerosis: a genetic screen of 100 type I interferon-inducible genes.
16171819 2005 Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.
15990456 2005 Promoter polymorphisms of the interferon-alpha receptor gene and development of Interferon-induced depressive symptoms in patients with chronic hepatitis C: preliminary findings.
15946680 2005 Functional cartography of the ectodomain of the type I interferon receptor subunit ifnar1.
15885318 2005 IFNAR1 and IFNAR2 polymorphisms confer susceptibility to multiple sclerosis but not to interferon-beta treatment response.
15589821 2004 The IFNAR1 subunit of the type I IFN receptor complex contains a functional nuclear localization sequence.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15449939 2004 Identification of residues of the IFNAR1 chain of the type I human interferon receptor critical for ligand binding and biological activity.
15337770 2004 Phosphorylation and specific ubiquitin acceptor sites are required for ubiquitination and degradation of the IFNAR1 subunit of type I interferon receptor.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
14727154 2004 LRP5, low-density-lipoprotein-receptor-related protein 5, is a determinant for bone mineral density.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14647450 2004 A role for Janus kinases in crosstalk between ErbB3 and the interferon-alpha signaling complex in myeloma cells.
14532120 2003 SCF(HOS) ubiquitin ligase mediates the ligand-induced down-regulation of the interferon-alpha receptor.
12761564 2003 Interferon-alpha receptor-1 (IFNAR1) variants are associated with protection against cerebral malaria in the Gambia.
12697242 2003 The dinucleotide microsatellite polymorphism of the IFNAR1 gene promoter correlates with responsiveness of hepatitis C patients to interferon.
12620806 2003 Measles virus suppresses interferon-alpha signaling pathway: suppression of Jak1 phosphorylation and association of viral accessory proteins, C and V, with interferon-alpha receptor complex.
12618863 2003 Pharmacogenomic analysis of interferon receptor polymorphisms in multiple sclerosis.
12554654 2003 The tyrosine kinase Tyk2 controls IFNAR1 cell surface expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220192 2002 Affinity of Stat2 for the subunits of the interferon alpha receptor.
11786546 2002 Stat2 binding to the interferon-alpha receptor 2 subunit is not required for interferon-alpha signaling.
11694501 2001 TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.
11167825 2001 Engagement of the CrkL adaptor in interferon alpha signalling in BCR-ABL-expressing cells.
10830953 2000 The DNA sequence of human chromosome 21.
10542297 1999 Catalytically active TYK2 is essential for interferon-beta-mediated phosphorylation of STAT3 and interferon-alpha receptor-1 (IFNAR-1) but not for activation of phosphoinositol 3-kinase.
10049744 1999 Formation of a uniquely stable type I interferon receptor complex by interferon beta is dependent upon particular interactions between interferon beta and its receptor and independent of tyrosine phosphorylation.
9733772 1998 Specific contribution of Tyk2 JH regions to the binding and the expression of the interferon alpha/beta receptor component IFNAR1.
9677371 1998 Identification of amino acid residues critical for the Src-homology 2 domain-dependent docking of Stat2 to the interferon alpha receptor.
9174595 1997 Post-translational up-regulation of the cell surface-associated alpha component of the human type I interferon receptor during differentiation of peripheral blood monocytes: role in the biological response to type I interferon.
9121453 1997 Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.
9029147 1997 A protein-arginine methyltransferase binds to the intracytoplasmic domain of the IFNAR1 chain in the type I interferon receptor.
8626489 1996 Direct association of STAT3 with the IFNAR-1 chain of the human type I interferon receptor.
8605876 1996 Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.
8307198 1994 Identification of mRNAs encoding two different soluble forms of the human interferon alpha-receptor.
8181059 1994 The human interferon alpha/beta receptor: characterization and molecular cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7665574 1995 Cloning and expression of a long form of the beta subunit of the interferon alpha beta receptor that is required for signaling.
7559568 1995 Interaction of the transcriptional activator Stat-2 with the type I interferon receptor.
7526154 1994 Direct binding to and tyrosine phosphorylation of the alpha subunit of the type I interferon receptor by p135tyk2 tyrosine kinase.
2153461 1990 Genetic transfer of a functional human interferon alpha receptor into mouse cells: cloning and expression of its cDNA.
2148760 1990 Assignment of the human interferon-alpha receptor gene to chromosome 21q22.1 by in situ hybridization.
1834641 1991 Human interferon omega (omega) binds to the alpha/beta receptor.
1370833 1992 The structure of the human interferon alpha/beta receptor gene.
1350660 1992 Introns in sequence tags.