Property Summary

NCBI Gene PubMed Count 19
PubMed Score 53.60
PubTator Score 28.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Melanoma 711 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Disease Target Count
Pancreatic Neoplasm 85
Disease Target Count Z-score Confidence
Myiasis 8 3.34 1.7
Pityriasis rubra pilaris 4 3.014 1.5

Protein-protein Interaction (9)

Gene RIF (57)

AA Sequence

MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQ      1 - 70
FQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSI     71 - 140
LTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE                         141 - 189
//

Text Mined References (19)

PMID Year Title