Property Summary

NCBI Gene PubMed Count 108
PubMed Score 2358.53
PubTator Score 2763.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Hepatitis C 94 7.178 3.6
Hepatitis B 108 5.579 2.8
Leukopenia 72 4.409 2.2
Thrombocytopenia 197 3.88 1.9
Anemia 365 3.269 1.6
Polycythemia vera 27 3.238 1.6
Diarrhea 253 3.227 1.6
Abdominal Pain 98 0.0 0.0
Acute kidney injury 70 0.0 0.0
Anemia, Hemolytic 55 0.0 0.0
Anorexia 43 0.0 0.0
Anxiety Disorders 38 0.0 0.0
Carcinoma, Renal Cell 124 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinoma, Transitional Cell 32 0.0 0.0
Chemical and Drug Induced Liver Injury 195 0.0 0.0
Chills 2 0.0 0.0
Colorectal Neoplasms 243 0.0 0.0
Depressive disorder 409 0.0 0.0
Fatigue 182 0.0 0.0
Fatty Liver 70 0.0 0.0
Fever 138 0.0 0.0
Flavivirus Infections 1 0.0 0.0
Headache 37 0.0 0.0
Hemangioendothelioma, Epithelioid 1 0.0 0.0
Hepatitis B, Chronic 7 0.0 0.0
Hepatitis C, Chronic 3 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hodgkin Disease 15 0.0 0.0
Hypertriglyceridemia 17 0.0 0.0
Intestinal perforation 7 0.0 0.0
Leukemia, Myelogenous, Chronic, BCR-ABL Positive 20 0.0 0.0
Leukemia-Lymphoma, Adult T-Cell 30 0.0 0.0
Liver Cirrhosis, Experimental 769 0.0 0.0
Lymphoma, Follicular 18 0.0 0.0
Lymphoma, Non-Hodgkin 24 0.0 0.0
Melanoma 711 0.0 0.0
Meningism 1 0.0 0.0
Mental disorders 12 0.0 0.0
Multiple myeloma 1332 0.0 0.0
Myocardial Infarction 151 0.0 0.0
Nausea 20 0.0 0.0
Neutropenia 72 0.0 0.0
Optic Neuropathy, Ischemic 1 0.0 0.0
Pain 103 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Polyomavirus Infections 7 0.0 0.0
Raynaud disease 6 0.0 0.0
Renal Insufficiency 90 0.0 0.0
Retinal Detachment 51 0.0 0.0
Retinal Diseases 55 0.0 0.0
Sepsis 24 0.0 0.0
Skin Diseases 71 0.0 0.0
Somatoform Disorders 1 0.0 0.0
Stevens-Johnson syndrome 92 0.0 0.0
Stomatitis 21 0.0 0.0
Substance Withdrawal Syndrome 55 0.0 0.0
Thrombocythemia, Essential 12 0.0 0.0
Thyroid Neoplasms 34 0.0 0.0
Tinnitus 19 0.0 0.0
Urinary Bladder Neoplasms 114 0.0 0.0
Uveomeningoencephalitic Syndrome 3 0.0 0.0
Viremia 1 0.0 0.0
Vomiting 116 0.0 0.0
Weight Loss 24 0.0 0.0
glioblastoma 5792 0.0 0.0
pterygium 76 0.0 0.0

 HCA RNA Cell Line (1)

Protein-protein Interaction (4)

Gene RIF (130)

AA Sequence

MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQF      1 - 70
QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL     71 - 140
AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE                          141 - 188
//

Text Mined References (113)

PMID Year Title