Property Summary

NCBI Gene PubMed Count 103
PubMed Score 2309.71
PubTator Score 2763.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

 HCA RNA Cell Line (1)

Gene RIF (123)

PMID Text
27087087 Report biased expression of human interferon alpha-2b and Escherichia coli methionine amino peptidase genes under control of single promoter in E. coli.
26679999 Data suggest IFNA2 binding to extracellular domain of IFN receptors IFNAR1 or IFNAR2 promotes proximity between intracellular domains; signaling depends on duration of activation and affinity of binding rather than specific conformational changes.
25995245 IFN-beta was significantly more effective than IFNA2 in protecting human head and neck squamous cell carcinoma lines from oncolysis by vesicular stomatitis.
25982860 The structure, mechanism of action and biological activities of IFNalpha2. [Review]
25972534 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
25837663 interferon alpha-2b gene mutations were identified among brain tumor patients; highest percentage of frameshift mutations was identified; patients were found to be under environmental stress from contaminated drinking water and from local gamma radiations
25768396 The chronic use of low dose of radiations by occupational workers has a significant correlation with mutational effects on interferon alpha 2b gene, further evident by depressed interferon alpha levels in serum.
25734487 PPARalpha activation by an agonist WY-14643 could potentiate IFN-alpha responses, reverse IFN-alpha refractoriness, and enhance viral eradication in hepatocytes.
25678471 modulates transitional B cell signaling and function in Systemic Lupus Erythematosus patients
25049393 these findings establish critical and essential roles for SKAR in the regulation of mRNA translation of IFN-sensitive genes and induction of IFN-alpha biological responses.
24866020 IFN-1ant may be a therapeutic candidate for the treatment of specific viral infections without inducing the immunomodulatory and antiproliferative functions of wild-type IFN.
24709112 Our data demonstrate disturbances in DC number and function expressed most significantly in T1D relatives and point to a potential role of TLR9-induced IFN-alpha production in T1D development.
24636575 Hepatitis B virus could induce both SOCS-1 and 3 expression regardless of endogenous interferon level.
24465874 IFNalpha serum marker could be used to identify a group of rheumatoid Arthritis patients with increased disease activity, endothelial progenitor cell imbalance, enhanced proinflammatory profile and higher cardiovascular risk.
24460759 Therefore, this study associated, for the first time, in a large panel of pancreatic cancer cell lines the effects of IFN-alpha/-beta with the expression of type-I IFN receptors.
24269682 Data indicate the ability of C protein to block Toll-like receptor (TLR) 7- and TLR9-dependent IFN-alpha induction.
24089560 IFNA2 inhibits viral protein expression through PKR activation, leading to a decrease of viral protein synthesis.
23913484 IL6 is an inducer of IRF9 expression in prostate cancer and a sensitizer for the antiproliferative effects of IFNalpha2.
23437155 These studies identify IFNalpha derived from lymph nodes, rather than blood leukocytes, as a possible source of the IFN-I signature that contributes to immune activation in HIV-1 infection
23255800 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23213068 The association with clinical disease and activation of multiple inflammatory cytokines supports a role for IFN-alpha2 in disease perpetuation in a large subset of systemic lupus erythematosis patients.
23184955 analysis of how an N-acetylgalactosamine residue at threonine 106 modifies the dynamics and structure of interferon alpha2a around the glycosylation site
23100517 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
23055569 The authors concluded that IFN-alpha-induced inhibition of miR-122 may negatively affect the anti-hepatitis B virus function of IFN-alpha.
22951153 Obese subjects showed a decreased ability to produce IFN-alpha and IFN-beta in response to TLR ligands; this response was associated with increased basal levels of SOCS3 but not SOCS1.
22885264 Successful immunostimulation by IFNalpha2b may help tongue squamous cell carcinoma patients in clinical improvement.
22814248 Data indicate that concomitant treatment with gp120 reduced the levels of IFN-alpha, IFN-beta, TNF-alpha, IL-6, and IP-10 induced by CpG-A in plasmacytoid dendritic cells.
22814248 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22739040 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22731491 interferon-stimulated genes which exerts its negative feedback action by taking advantage of the weakness of IFNalpha2 binding to the receptor
22685550 Data indicate that the combination of AAV2.IL-4 and AAV2.IFN-alpha was not significantly different as compared to AAV2.IL-4 alone.
22610944 Results showed that missense mutations in transmembrane protein 2 p.Ser1254Asn, interferon alpha 2 p.Ala120Thr, its regulator NLR family member X1 p.Arg707Cys, and complement component 2 p.Glu318Asp were associated with chronic hepatitis B.
22610275 monocytes manage the impact of TNF-alpha and type I/II interferons in rheumatoid arthritis and systemic lupus erythematosus
22571879 Pre-treatment waking hypothalamic-pituitary-adrenal (HPA) axis response is greater in subjects switching to major depressive disorder during INFalpha2a treatment and may constitute a vulnerability factor in patients with hepatitis C virus infection.
22570109 variation at IFNA2 -173 and IFNA8 -884 conditions reduced IFN-alpha production, and increased susceptibility to SMA and mortality
22482409 Data indicate that the production of IFN-alpha in supernatant of transfected cells was about 3.15 ng/mL.
22332739 protein kinase, DNA-activated catalytic polypeptide (PRKDC), was confirmed to play a role in MyD88-induced IFNA2 activation and IL-8 secretion
22315404 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
22204827 IFNalpha rapidly down-regulates BCL-6 mRNA in purified mouse normal germinal center B cells.
21854986 The crystal structures of two human type I IFN ternary signaling complexes containing IFNalpha2 and IFNomega reveal recognition modes and heterotrimeric architectures that are unique among the cytokine receptor superfamily but conserved between type I IFNs.
21757613 Structural AA changes in the C-helix interacting with IFNAlphaR1 may change the signaling dynamics leading to elevated APOBEC3 & lower IDO by an engineered mutant derived from the amino-terminal region of IFNalpha21b and the COOH-terminus from IFNalpha2c.
21466707 Interferon alpha 2 regulates MAPK and STAT1 pathways in human hepatoma cells.
21411783 Degos disease is a distinct vascular injury syndrome whereby a dysregulated interferon-alpha response in concert with membranolytic attack complex deposition may contribute to the unique vascular changes.
21223583 we have demonstrated that IFNalpha2, a type I interferon, increases the expression of TLR3 on human dermal fibroblasts
21115688 Data show that pDCs and type I IFNs promote inflammatory responses and wound healing in injured skin.
21057730 Studies indicate that it remains unclear whether interruption of IFNalphaA and IL-10 signaling in the absence of CD73 activity results from a deficiency of its product adenosine or an accumulation of its substrate nucleotides.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20574843 Observational study of gene-disease association. (HuGE Navigator)
20532927 The result suggests that hyper-induction of TNF-alpha in human macrophages is not always associated with a highly pathogenic phenotype of avian and human influenza viruses.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20309637 These findings indicate that the expression of MxA, 2',5'-OAS and PKR are up-regulate by PI3K-AKT signal pathway, and Raf-MEK-ERK signal pathway has a negative regulatory effect on the expression of MxA and no significant effect on 2',5'-OAS and PKR.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20159042 Strategies are described to maximize expression of rightly processed human INF alpha2b protein in Pichia.
19790049 C1q inhibits immune complex-induced interferon-alpha production in plasmacytoid dendritic cells.
19706714 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
19621225 Data show that serum concentrations of pegylated interferon alpha-2b increased in a dose-related manner.
19574459 Pharmacological inhibition of Mnk kinases or siRNA-mediated knockdown of Mnk1 and Mnk2 results in partial reversal of the suppressive effects of IFNalpha on normal and leukemic hematopoietic progenitors.
19564411 Results suggest that the differential activities of the interferon subtypes alpha2 and beta are dictated not only by the intrinsic ligand/receptor binding kinetics but also by the density of cell surface receptor components.
19559726 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
19345260 IFNalpha-mediated downregulation of Hepatitis C virus gene expression is abolished by acrolein, a major component of cigarette smoke
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19153447 analysis of the complex between a human anti-interferon antibody fragment and human interferon alpha-2A
19055755 The worldwide distribution of indel polymorphism in the gene coding for IFNA2 was analyzed.
19055755 Observational study of gene-disease association. (HuGE Navigator)
19004943 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
19000144 This is the first report of positive association of IFNA gene in SLE, especially the role of specific subtypes IFNA1 and IFNA5.
19000144 Observational study of gene-gene interaction. (HuGE Navigator)
18937499 Mutation of the IFNAR-1 receptor binding site of human IFN-alpha2 generates type I IFN competitive antagonists.
18729739 IFN-alpha2b possibly controls chemotaxis by regulating the interaction between CXCL10 and CXCR3A
18672082 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
18584346 Recombinant INFA2 may have antitumor activity against Merkel cell carcinoma.
18414664 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
18272764 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
18200012 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
18200009 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
18032529 Recombinant human IFN-alpha 2b causes programmed cell death in nondiseased renal epithelial cells. IFN-alpha-induced apoptosis is directed by an extrinsic death receptor signaling pathway, amplified by an intrinsic mitochondrial pathway.
18027911 Results demonstrated that two individual IFN-alphas interact differentially with IFNAR2-EC and influence each other during this interaction.
18005734 we propose that HIV-1 expresses Vpu to counteract an IFNalpha-induced, general host defense that inhibits dissemination of enveloped virions from the surface of infected cells.
18005734 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
17880940 IFNalpha is able to interfere with IL-6 signaling by inhibiting STAT3 activity and the abrogation of STAT3 activity accounts for the ability of IFNalpha to induce apoptosis in myeloma cells.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17477817 study reports that, in addition to promoting T cell chemotaxis, IFN-alpha2 enhances T cell adhesion to integrin ligands, which is associated with integrin clustering on the T cell surface and enhanced conjugate formation with dendritic cells
17360657 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
17181634 Differential transcription occurring early in atopic dermatitis skin was indicated for CCL18, CCL13, IFNalpha2, PPARalpha and PPARgamma.
17180012 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
17116765 Plasmacytoid dendritic cells in atherosclerotic plaque sense microbial motifs and amplify cytolytic T-cell functions. IFN-alpha emerged as a potent regulator of T-cell function.
16920161 Observational study of gene-disease association. (HuGE Navigator)
16920161 Findings indicate that the deletion in the promoter of the IFN-alpha-2 gene reduces the transcription of this gene in vitro and this could also be one cause of susceptibility to hepatitis B.
16697656 In vivo induction of ITGA-11 is detected in spleen and lungs of human recombinant IFN-alpha 2-treated BALB/c mice.
16418394 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
16375755 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
16278001 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
16171819 Data describe the mapping of the complete binding region of IFNAR1 on IFNalpha2 using a panel of 21 single alanine mutant proteins.
16160188 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
15481145 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
15004750 Possession of the IFNA17 polymorphism (551T-->G), with higher levels of IFN-alpha significantly increases the risk of sarcoidosis.
12089333 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
12010658 Angiogenic activity of rat mast cells in the chick embryo chorioallantoic membrane is down-regulated by treatment with recombinant human alpha-2a interferon and partly mediated by fibroblast growth factor-2. (alpha-2a interferon)
9865497 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9658081 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9520456 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9343822 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9225992 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9181467 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
9108403 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
8764000 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
8668211 Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
8661419 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
8438572 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
8345204 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7913356 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7904170 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7815507 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7583919 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7532202 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7526537 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
7511078 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
2552026 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
2014240 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
1905933 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
1708818 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A
1381203 HIV-1 isolate R3A Nef mutants G2, WL58, RR106, LL165, E160NNSLL165, and DD175 fail to induce release of IFN-alpha in pDCs, suggesting that the Nef function responsible for CD4 downregulation is crucial for pDCs stimulation by R3A

AA Sequence

MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQF      1 - 70
QKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSIL     71 - 140
AVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE                          141 - 188
//

Text Mined References (108)

PMID Year Title
27087087 2016 Biased expression, under the control of single promoter, of human interferon ?-2b and Escherichia coli methionine amino peptidase genes in E. coli, irrespective of their distance from the promoter.
26679999 2016 Type I Interferon Signaling Is Decoupled from Specific Receptor Orientation through Lenient Requirements of the Transmembrane Domain.
25995245 2015 Interferon Beta and Interferon Alpha 2a Differentially Protect Head and Neck Cancer Cells from Vesicular Stomatitis Virus-Induced Oncolysis.
25982860 2015 IFNA2: The prototypic human alpha interferon.
25837663 2015 Mutations of the human interferon alpha-2b gene in brain tumor patients exposed to different environmental conditions.
25768396 2015 Mutations of the human interferon alpha-2b (hIFN-?2b) gene in occupationally protracted low dose radiation exposed personnel.
25734487 2015 The Mechanism of Interferon Refractoriness During Hepatitis C Virus Infection and Its Reversal with a Peroxisome Proliferator-Activated Receptor ? Agonist.
25678471 2015 Interferon-? induces altered transitional B cell signaling and function in Systemic Lupus Erythematosus.
25049393 2014 Regulatory effects of SKAR in interferon ? signaling and its role in the generation of type I IFN responses.
24866020 2014 Multifaceted activities of type I interferon are revealed by a receptor antagonist.
24709112 2014 Decreased dendritic cell numbers but increased TLR9-mediated interferon-alpha production in first degree relatives of type 1 diabetes patients.
24636575 2014 Correlation between the suppressor of cytokine signaling-1 and 3 and hepatitis B virus: possible roles in the resistance to interferon treatment.
24465874 2014 IFN? serum levels are associated with endothelial progenitor cells imbalance and disease features in rheumatoid arthritis patients.
24460759 2014 Influence of type-I Interferon receptor expression level on the response to type-I Interferons in human pancreatic cancer cells.
24269682 2014 An anti-interferon activity shared by paramyxovirus C proteins: inhibition of Toll-like receptor 7/9-dependent alpha interferon induction.
24089560 2013 Alpha interferon restricts human T-lymphotropic virus type 1 and 2 de novo infection through PKR activation.
23913484 2013 IL6 sensitizes prostate cancer to the antiproliferative effect of IFN?2 through IRF9.
23875128 2013 Heterologous expression, immunochemical and computational analysis of recombinant human interferon alpha 2b.
23437155 2013 Interferon-? is the primary plasma type-I IFN in HIV-1 infection and correlates with immune activation and disease markers.
23213068 2013 Circulating interferon-?2 levels are increased in the majority of patients with systemic lupus erythematosus and are associated with disease activity and multiple cytokine activation.
23184955 2013 A single N-acetylgalactosamine residue at threonine 106 modifies the dynamics and structure of interferon ?2a around the glycosylation site.
23055569 2013 Inhibition of alpha interferon (IFN-?)-induced microRNA-122 negatively affects the anti-hepatitis B virus efficiency of IFN-?.
22951153 2013 Decreased interferon-? and interferon-? production in obesity and expression of suppressor of cytokine signaling.
22885264 2012 IFN?2b augments immune responses of cisplatin+5-fluorouracil treated tongue squamous cell carcinoma patients--a preliminary study.
22814248 2012 Inhibitory effects of human immunodeficiency virus gp120 and Tat on CpG-A-induced inflammatory cytokines in plasmacytoid dendritic cells.
22783022 2012 The Sin3a repressor complex is a master regulator of STAT transcriptional activity.
22731491 2012 USP18 establishes the transcriptional and anti-proliferative interferon ?/? differential.
22685550 2012 AAV2-mediated combined subretinal delivery of IFN-? and IL-4 reduces the severity of experimental autoimmune uveoretinitis.
22610944 2012 Rare inborn errors associated with chronic hepatitis B virus infection.
22610275 2012 The multifaceted balance of TNF-? and type I/II interferon responses in SLE and RA: how monocytes manage the impact of cytokines.
22571879 2012 Pre-treatment waking cortisol response and vulnerability to interferon ? induced depression.
22570109 2012 Reduced interferon (IFN)-? conditioned by IFNA2 (-173) and IFNA8 (-884) haplotypes is associated with enhanced susceptibility to severe malarial anemia and longitudinal all-cause mortality.
22482409 2012 [Construction and expression of the efficient recombinant plasmid pEE14.1-IFN-? expressing human IFN-?].
22332739 siRNA high-throughput kinase library screen identifies protein kinase, DNA-activated catalytic polypeptide to play a role in MyD88-induced IFNA2 activation and IL-8 secretion.
22204827 2012 Type I interferons directly down-regulate BCL-6 in primary and transformed germinal center B cells: differential regulation in B cell lines derived from endemic or sporadic Burkitt's lymphoma.
21854986 2011 Structural linkage between ligand discrimination and receptor activation by type I interferons.
21757613 2011 Structural variants of IFN? preferentially promote antiviral functions.
21466707 2011 Interferon alpha regulates MAPK and STAT1 pathways in human hepatoma cells.
21411783 2011 Degos disease: a C5b-9/interferon-?-mediated endotheliopathy syndrome.
21223583 2011 Toll-like receptor 3 upregulation by type I interferon in healthy and scleroderma dermal fibroblasts.
21115688 2010 Plasmacytoid dendritic cells sense skin injury and promote wound healing through type I interferons.
21057730 2010 CD73-dependent regulation of interferon ?A and interleukin-10 in the inflamed mucosa.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20574843 2010 Associations of 9p21 variants with cutaneous malignant melanoma, nevi, and pigmentation phenotypes in melanoma-prone families with and without CDKN2A mutations.
20554961 2010 Cutting edge: Type I IFN reverses human Th2 commitment and stability by suppressing GATA3.
20532927 2010 Induction of TNF-alpha in human macrophages by avian and human influenza viruses.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20496919 2010 Intermolecular interactions in a 44 kDa interferon-receptor complex detected by asymmetric reverse-protonation and two-dimensional NOESY.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20309637 2011 IL-29 and IFN-? regulate the expression of MxA, 2',5'-OAS and PKR genes in association with the activation of Raf-MEK-ERK and PI3K-AKT signal pathways in HepG2.2.15 cells.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20159042 2010 Strategies to maximize expression of rightly processed human interferon alpha2b in Pichia pastoris.
19790049 2009 C1q inhibits immune complex-induced interferon-alpha production in plasmacytoid dendritic cells: a novel link between C1q deficiency and systemic lupus erythematosus pathogenesis.
19621225 2010 Serum concentrations of pegylated interferon alpha-2b in patients with resected stage III melanoma receiving adjuvant pegylated interferon alpha-2b in a randomized phase III trial (EORTC 18991).
19574459 2009 Type I interferon (IFN)-dependent activation of Mnk1 and its role in the generation of growth inhibitory responses.
19564411 2009 Receptor density is key to the alpha2/beta interferon differential activities.
19345260 2009 Acrolein, a ubiquitous pollutant and lipid hydroperoxide product, inhibits antiviral activity of interferon-alpha: relevance to hepatitis C.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19153447 2009 Crystallization and preliminary X-ray diffraction analysis of the complex between a human anti-interferon antibody fragment and human interferon alpha-2A.
19055755 2008 A globally occurring indel polymorphism in the promoter of the IFNA2 gene is not associated with severity of malaria but with the positivity rate of HCV.
19000144 2008 Genetic association of interferon-alpha subtypes 1, 2 and 5 in systemic lupus erythematosus.
18937499 2008 Mutation of the IFNAR-1 receptor binding site of human IFN-alpha2 generates type I IFN competitive antagonists.
18729739 2008 Interferon-alpha2b restores the impaired chemotactic activity of peripheral blood mononuclear cells from head and neck squamous cell carcinoma patients by modulating CXC receptor ligand interaction.
18584346 2008 Interferon-alpha inhibits proliferation and induces apoptosis of merkel cell carcinoma in vitro.
18032529 2008 IFN-alpha induces barrier destabilization and apoptosis in renal proximal tubular epithelium.
18027911 2007 Two interferons alpha influence each other during their interaction with the extracellular domain of human type interferon receptor subunit 2.
18005734 2007 An interferon-alpha-induced tethering mechanism inhibits HIV-1 and Ebola virus particle release but is counteracted by the HIV-1 Vpu protein.
17880940 2007 Interferon alpha induces cell death through interference with interleukin 6 signaling and inhibition of STAT3 activity.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17477817 2007 IFN-alpha2 induces leukocyte integrin redistribution, increased adhesion, and migration.
17275127 2007 HCV NS5A inhibits interferon-alpha signaling through suppression of STAT1 phosphorylation in hepatocyte-derived cell lines.
17181634 2007 Early cutaneous gene transcription changes in adult atopic dermatitis and potential clinical implications.
17116765 2006 Pathogen-sensing plasmacytoid dendritic cells stimulate cytotoxic T-cell function in the atherosclerotic plaque through interferon-alpha.
17001036 2006 Determination of the human type I interferon receptor binding site on human interferon-alpha2 by cross saturation and an NMR-based model of the complex.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16920161 2006 A promoter polymorphism in the interferon alpha-2 gene is associated with the clinical presentation of hepatitis B.
16697656 2006 Integrin alpha 11 is a novel type I interferon stimulated gene.
16171819 2005 Mutational analysis of the IFNAR1 binding site on IFNalpha2 reveals the architecture of a weak ligand-receptor binding-site.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15233997 2004 Characterization of the type I interferon locus and identification of novel genes.
15004750 2004 Association between IFNA genotype and the risk of sarcoidosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12010658 2002 Angiogenic activity of rat mast cells in the chick embryo chorioallantoic membrane is down-regulated by treatment with recombinant human alpha-2a interferon and partly mediated by fibroblast growth factor-2.
11888273 2002 The human interferon receptor: NMR-based modeling, mapping of the IFN-alpha 2 binding site, and observed ligand-induced tightening.
11694501 2001 TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.
10477584 1999 Recombinant IFN-alpha (2b) increases the expression of apoptosis receptor CD95 and chemokine receptors CCR1 and CCR3 in monocytoid cells.
10339405 1999 Biophysical analysis of the interaction of human ifnar2 expressed in E. coli with IFNalpha2.
9694076 A defective retroviral vector encoding human interferon-alpha2 can transduce human leukemic cell lines.
9425112 1998 Identification of nine interferon-alpha subtypes produced by Sendai virus-induced human peripheral blood leucocytes.
9417943 1997 The three-dimensional high resolution structure of human interferon alpha-2a determined by heteronuclear NMR spectroscopy in solution.
8994971 1996 Zinc mediated dimer of human interferon-alpha 2b revealed by X-ray crystallography.
8668211 1996 Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
8366289 1993 Analysis of interferon-alpha 2 sequences in human genomic DNA.
8234245 1993 A homology model of human interferon alpha-2.
7759950 1995 Soluble and membrane-anchored forms of the human IFN-alpha/beta receptor.
7627809 1995 Interferon-alpha 2 variants in the human genome.
6310510 1983 Formation of genes coding for hybrid proteins by recombination between related, cloned genes in E. coli.
6170983 1981 DNA sequence of a major human leukocyte interferon gene.
6164056 1980 Construction and identification of bacterial plasmids containing nucleotide sequence for human leukocyte interferon.
6163083 1981 The structure of eight distinct cloned human leukocyte interferon cDNAs.
6162107 1981 Assignment of the disulphide bonds of leukocyte interferon.
6159538 1980 Human leukocyte interferon produced by E. coli is biologically active.
6159537 1980 A family of structural genes for human lymphoblastoid (leukocyte-type) interferon.
6158094 1980 At least three human type alpha interferons: structure of alpha 2.
3906813 [Cloning of human leukocyte interferon cDNA and a strategy for its production in E. coli].
2049076 1991 Natural human interferon-alpha 2 is O-glycosylated.
1834641 1991 Human interferon omega (omega) binds to the alpha/beta receptor.
1385305 1992 Mapping of the shortest region of overlap of deletions of the short arm of chromosome 9 associated with human neoplasia.