Property Summary

NCBI Gene PubMed Count 56
PubMed Score 126.00
PubTator Score 69.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
systemic lupus erythematosus 1.200 1.3e-04
esophageal adenocarcinoma 1.100 2.3e-02
glioblastoma 2.100 2.6e-02
medulloblastoma, large-cell -1.700 2.8e-03
Duchenne muscular dystrophy 1.016 1.2e-06
juvenile dermatomyositis 2.145 2.8e-18
acute quadriplegic myopathy 1.048 6.4e-05
tuberculosis 1.400 1.1e-04
intraductal papillary-mucinous adenoma (... -2.200 9.6e-05
intraductal papillary-mucinous carcinoma... -1.500 2.0e-02
lung cancer -1.700 3.9e-04
active Crohn's disease 1.644 2.3e-02
ulcerative colitis 2.100 1.4e-08
Multiple Sclerosis 1.600 1.7e-03
interstitial cystitis 1.100 2.6e-04
group 4 medulloblastoma -1.400 1.9e-04
posterior fossa group A ependymoma 1.200 1.8e-06
non-inflammatory breast cancer 1.200 1.0e-02
lung carcinoma -1.800 3.9e-25
acute myeloid leukemia -2.000 2.9e-02
ovarian cancer 1.700 2.8e-06
pituitary cancer -2.200 3.7e-06
Down syndrome 1.200 2.7e-02
dermatomyositis 1.300 1.1e-02

Gene RIF (51)

PMID Text
26387945 IFITM2 and IFITM3 specifically antagonize the HIV-1 envelope glycoprotein (Env), thereby inhibiting viral infection.
26387945 HIV-1 gp120 shedding is induced by IFITM3
26387945 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26263374 we demonstrate that the E3 ubiquitin ligase NEDD4 ubiquitinates IFITM3 in cells and in vitro.
26116899 HIV-1 gp120 shedding is induced by IFITM3
25942469 Our meta-analysis suggests a significant association between a minor IFITM3 allele (SNP rs12252-C) with severe influenza susceptibility, but not in mild influenza subjects
25784441 A novel association between IFITM3 gene polymorphism and rapid disease progression is reported in an acute HIV-1-infected MSM cohort in China.
25778715 This meta-analysis suggests that IFITM3 rs12252 T>C polymorphism is significantly associated with increased risk of severe influenza but not with the chance of initial virus infection.
25552713 Host IFITM3,IFITM2 and IFITM1 facilitate morphogenesis of the human cytomegalovirus assembly.
25464829 Incorporation of IFITM1, IFITM2 and IFITM3 into HIV-1 virions impair viral fusion and spread.
25464829 HIV-1 gp120 shedding is induced by IFITM3
25464829 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
25463599 HIV-1 gp120 shedding is induced by IFITM3
25422070 In virus-producing cells, IFITMs coalesce with forming virions and are incorporated into HIV-1 viral particles.
25422070 HIV-1 gp120 shedding is induced by IFITM3
25422070 HIV-1 infectivity is inhibited when IFITM3 is expressed by the virus producing cell (293T cells)
25405885 Authors suggest that IFITM3 adopts multiple membrane topologies involving at least one intramembrane domain in its antivirally active conformation.
25314048 Tyrosine 20 partially regulates the subcellular localization of IFITM3 but is not functionally essential for IFITM3-mediated H1N1 restriction.
25270246 Taken together, these data suggested that IFITM3 is a potential therapeutic target for GC.
24978204 Exposure of A(H1N1)pdm09-infected epithelial cells to HIV-1 viral particles or its gp120 enhanced by 25% the IFITM3 content. resulting in a decrease in influenza replication.
24978204 HIV-1 gp120 shedding is induced by IFITM3
24699674 IFITM3 may redirect IAV fusion to a non-productive pathway, perhaps by promoting fusion with intralumenal vesicles within multivesicular bodies/late endosomes.
24521078 As an endocytic protein, IFITM3 first arrives at the plasma membrane before it is endocytosed and further traffics to the late endosomes where it acts to impede virus entry.
24370119 The findings of this study provided new evidence that IFITM3 plays an important role in glioma cell growth and migration.
24367104 The IFITM3 genotype is a primary driver of the observed differences in clinical outcome after H7N9 infection.
24129573 Vesicular stomatitis virus and influenza A virus increased IFITM3-K88me1 levels by promoting the interaction between IFITM3 and SET7, suggesting that this pathway could be hijacked to support infection; conversely, IFN-alpha reduced IFITM3-K88me1 levels.
24076421 HIV-1 gp120 shedding is induced by IFITM3
23997235 Authors found evidence of an association between rs12252 rare allele homozygotes and susceptibility to mild influenza (in patients attending primary care).
23874452 rs3888188, a functional promoter polymorphism of IFITM3, was identified to influence the risk for pediatric TB in Han Chinese population.
23720721 Authors show that interferon-induced transmembrane protein 1 (IFITM-1), IFITM-2, and IFITM-3 exhibit a broad spectrum of antiviral activity against several members of the Bunyaviridae family.
23658454 The CD225 domain of IFITM3 is required for both IFITM protein association and inhibition of influenza A virus and dengue virus replication.
23649619 IFITM3 restricts infection by a nonenveloped virus.
23624618 IFITM3 protein was highly expressed in invasive breast cancer compared to normal tissues and was significantly associated with estrogen receptor and progesterone receptor status.
23601107 The antiviral effector protein interferon-inducible transmembrane protein 3 (IFITM3) interacts with VAPA and prevents its association with OSBP.
23376165 Although their inhibitory activities were modest when compared to that of tetherin, IFITMs, but not tetherin, directly reduced the expression of HIV-1 proteins including Gag, Vif and Nef.
23376165 HIV-1 gp120 shedding is induced by IFITM3
23361009 the CC genotype of ITITM3 is found in 69% of Chinese patients with severe pandemic influenza A H1N1/09 virus infection compared with 25% in those with mild infection.
23055554 HIV-1 gp120 shedding is induced by IFITM3
22511783 S-palmitoylation and ubiquitination differentially regulate interferon-induced transmembrane protein 3 (IFITM3)-mediated resistance to influenza virus.
22446628 data reveal that the action of a single intrinsic immune effector, IFITM3, profoundly alters the course of influenza virus infection in mouse and humans
21914072 To further investigate the 1-8U function with both in vivo and in vitro studies, the 1-8U gene was found to suppress cellular and hepatitis C virus internal ribosomal entry site-mediated translation.
21531817 IFITM3 was expressed at higher levels in colon tumors and, particularly, nodal metastases than in normal colon tissue.
21413873 promoter demethylation enhances transcriptional response to IFN-alpha treatment in melanoma cells
21177806 IFITM1, IFITM2, and IFITM3 inhibit HIV-1 replication through interfering with virus entry.
20534863 IFITM2 and IFITM3, disrupted early steps (entry and/or uncoating) of the viral infection, viperin, ISG20, and double-stranded-RNA-activated protein kinase, inhibited steps in west nile virus and dengue virus viral proteins and/or RNA biosynthesis.
19946179 gene polymorphism is associated with susceptibility to ulcerative colitis in Korean population
19946179 Observational study of gene-disease association. (HuGE Navigator)
19901966 This work has shown for the first time that IFITM3 physically interacts with OPN and reduces OPN mRNA expression
18470904 IFITM3 plays an important role in early colon cancer development
18177740 regulation of IFITM3 by TEF-1 demonstrates that TEF-1 dependent regulation is more widespread than its previously established role in the expression of muscle specific genes

AA Sequence

MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNP      1 - 70
CCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG            71 - 133
//

Text Mined References (62)

PMID Year Title
26387945 2015 IFITM Proteins Restrict HIV-1 Infection by Antagonizing the Envelope Glycoprotein.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26263374 2015 E3 Ubiquitin Ligase NEDD4 Promotes Influenza Virus Infection by Decreasing Levels of the Antiviral Protein IFITM3.
25942469 2015 Interferon-Inducible Transmembrane Protein 3 Genetic Variant rs12252 and Influenza Susceptibility and Severity: A Meta-Analysis.
25784441 2015 Interferon-induced transmembrane protein-3 rs12252-C is associated with rapid progression of acute HIV-1 infection in Chinese MSM cohort.
25778715 2015 IFITM3 rs12252 T>C polymorphism is associated with the risk of severe influenza: a meta-analysis.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25405885 2014 Regulation of the trafficking and antiviral activity of IFITM3 by post-translational modifications.
25314048 2014 IFITM3 polymorphism rs12252-C restricts influenza A viruses.
25270246 2014 Mechanism and biological significance of the overexpression of IFITM3 in gastric cancer.
24978204 2014 HIV-1 and its gp120 inhibits the influenza A(H1N1)pdm09 life cycle in an IFITM3-dependent fashion.
24699674 2014 IFITM3 restricts influenza A virus entry by blocking the formation of fusion pores following virus-endosome hemifusion.
24521078 2014 Identification of an endocytic signal essential for the antiviral action of IFITM3.
24370119 2013 The role of IFITM3 in the growth and migration of human glioma cells.
24367104 2014 Early hypercytokinemia is associated with interferon-induced transmembrane protein-3 dysfunction and predictive of fatal H7N9 infection.
24129573 2013 Negative regulation of interferon-induced transmembrane protein 3 by SET7-mediated lysine monomethylation.
23997235 2014 IFITM3 and susceptibility to respiratory viral infections in the community.
23874452 2013 A functional promoter polymorphism of IFITM3 is associated with susceptibility to pediatric tuberculosis in Han Chinese population.
23720721 2013 IFITM-2 and IFITM-3 but not IFITM-1 restrict Rift Valley fever virus.
23658454 2013 The CD225 domain of IFITM3 is required for both IFITM protein association and inhibition of influenza A virus and dengue virus replication.
23649619 2013 Interferon-inducible transmembrane protein 3 (IFITM3) restricts reovirus cell entry.
23624618 2013 Knockdown of interferon-induced transmembrane protein 3 expression suppresses breast cancer cell growth and colony formation and affects the cell cycle.
23601107 2013 The antiviral effector IFITM3 disrupts intracellular cholesterol homeostasis to block viral entry.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23376165 2013 Characteristics of IFITM, the newly identified IFN-inducible anti-HIV-1 family proteins.
23361009 2013 Interferon-induced transmembrane protein-3 genetic variant rs12252-C is associated with severe influenza in Chinese individuals.
23358889 2013 IFITM proteins restrict viral membrane hemifusion.
22511783 2012 S-palmitoylation and ubiquitination differentially regulate interferon-induced transmembrane protein 3 (IFITM3)-mediated resistance to influenza virus.
22479637 2012 IFITM proteins restrict antibody-dependent enhancement of dengue virus infection.
22446628 2012 IFITM3 restricts the morbidity and mortality associated with influenza.
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
22046135 2011 IFITM3 inhibits influenza A virus infection by preventing cytosolic entry.
21914072 2011 Identification of the IFITM3 gene as an inhibitor of hepatitis C viral translation in a stable STAT1 cell line.
21531817 2011 KLF4-mediated negative regulation of IFITM3 expression plays a critical role in colon cancer pathogenesis.
21413873 2011 Interferon-alpha induces reversible DNA demethylation of the interferon-induced transmembrane protein-3 core promoter in human melanoma cells.
21253575 2011 Distinct patterns of IFITM-mediated restriction of filoviruses, SARS coronavirus, and influenza A virus.
21177806 2011 The IFITM proteins inhibit HIV-1 infection.
21166591 2011 The small interferon-induced transmembrane genes and proteins.
20943977 2010 Interferon-induced cell membrane proteins, IFITM3 and tetherin, inhibit vesicular stomatitis virus infection via distinct mechanisms.
20601941 2010 Palmitoylome profiling reveals S-palmitoylation-dependent antiviral activity of IFITM3.
20534863 2010 Identification of five interferon-induced cellular proteins that inhibit west nile virus and dengue virus infections.
20064371 2009 The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus.
19946179 2010 Identification of the polymorphisms in IFITM3 gene and their association in a Korean population with ulcerative colitis.
19901966 2010 Interferon-induced transmembrane 3 binds osteopontin in vitro: expressed in vivo IFITM3 reduced OPN expression.
18486613 2008 Interactions between PBEF and oxidative stress proteins--a potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
18470904 2008 Gene-expression profiling in Chinese patients with colon cancer by coupling experimental and bioinformatic genomewide gene-expression analyses: identification and validation of IFITM3 as a biomarker of early colon carcinogenesis.
18177740 2008 Transcriptional enhancer factor 1 (TEF-1/TEAD1) mediates activation of IFITM3 gene by BRGl.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16326387 2005 IFITM/Mil/fragilis family proteins IFITM1 and IFITM3 play distinct roles in mouse primordial germ cell homing and repulsion.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10950117 2000 Differentially expressed genes in two LNCaP prostate cancer cell lines reflecting changes during prostate cancer progression.
1906403 1991 Molecular analysis of a human interferon-inducible gene family.