Property Summary

NCBI Gene PubMed Count 48
PubMed Score 118.28
PubTator Score 108.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
systemic lupus erythematosus 1.900 1.3e-04
Multiple myeloma 2.591 8.5e-03
malignant mesothelioma 3.700 4.9e-08
esophageal adenocarcinoma 1.400 4.3e-02
cutaneous lupus erythematosus 2.000 1.3e-04
cystic fibrosis 1.988 4.0e-03
medulloblastoma, large-cell -1.600 1.6e-03
Duchenne muscular dystrophy 1.259 7.2e-06
autosomal dominant Emery-Dreifuss muscul... 1.088 9.9e-03
juvenile dermatomyositis 3.064 1.6e-20
acute quadriplegic myopathy 1.129 7.1e-04
limb girdle muscular dystrophy 2A 1.106 1.1e-04
tuberculosis 1.200 2.3e-06
primary pancreatic ductal adenocarcinoma 1.073 2.4e-02
intraductal papillary-mucinous adenoma (... -2.200 1.2e-05
lung cancer -2.300 1.3e-05
colon cancer 1.100 1.0e-03
active Crohn's disease 1.532 1.9e-02
ulcerative colitis 2.100 8.4e-07
group 4 medulloblastoma -1.300 4.9e-03
posterior fossa group A ependymoma 1.600 7.9e-05
primary Sjogren syndrome 1.600 2.1e-03
Breast cancer 1.600 5.5e-06
ovarian cancer 2.300 2.4e-06
pituitary cancer -2.700 3.9e-07
Down syndrome 1.500 1.9e-02
pancreatic cancer 1.100 1.7e-02
dermatomyositis 1.700 8.8e-03

Protein-protein Interaction (1)

Gene RIF (49)

PMID Text
26897526 These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction.
26387945 HIV-1 gp41 interacts with IFITM1
26387945 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
26354436 propose that the IFITM proteins act in a coordinated manner to restrict HCV infection by targeting the endocytosed HCV virion for lysosomal degradation and demonstrate that the actions of the IFITM proteins are indeed virus and cell-type specific
26259513 Suggest that IFITM1 promotes the aggressiveness of colorectal cancer cells via caveolin-1 signaling.
26116899 HIV-1 gp41 interacts with IFITM1
25738301 the importance of the C-terminal region of IFITM1 in modulating the antiviral function through controlling protein subcellular localization.
25738301 HIV-1 gp41 interacts with IFITM1
25552713 Host IFITM3,IFITM2 and IFITM1 facilitate morphogenesis of the human cytomegalovirus assembly.
25464829 Incorporation of IFITM1, IFITM2 and IFITM3 into HIV-1 virions impair viral fusion and spread.
25464829 HIV-1 gp41 interacts with IFITM1
25464829 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
25463599 HIV-1 gp41 interacts with IFITM1
25422070 In virus-producing cells, IFITMs coalesce with forming virions and are incorporated into HIV-1 viral particles.
25422070 HIV-1 gp41 interacts with IFITM1
25422070 HIV-1 cell-to-cell transmission (Jurkat-to-Jurkat and PBMCs-to-Jurkat) is inhibited by IFITM1
24725927 HIV-1 gp41 interacts with IFITM1
24676393 IFITM1 could be a novel metastasis-promoting gene that enhances the metastatic phenotype in ovarian cancer via epigenetic transcriptional regulation.
24663101 HIV-1 gp41 interacts with IFITM1
24603679 IFITM1 is essential for the formation of functional blood vessels and stabilizes EC-EC interactions during endothelial lumen formation by regulating tight junction assembly.
24209773 Schizophrenia subjects with higher IFITM mRNA levels in cortical blood vessels have greater disturbances in cortical GABA neurons suggests that these cell-type disturbances might be influenced by a shared upstream insult that involves immune activation.
24120510 Results suggest that the g.-1920G>A polymorphism in interferon inducible transmembrane protein 1 (IFITM1) may be associated with susceptibility to ulcerative colitis (UC).
24076421 HIV-1 gp41 interacts with IFITM1
24072182 IFITM1 is a potential valuable addition to immunohistochemical panels used in the diagnosis of cellular mesenchymal uterine tumors.
23898208 HIV-1 gp41 interacts with IFITM1
23720721 Authors show that interferon-induced transmembrane protein 1 (IFITM-1), IFITM-2, and IFITM-3 exhibit a broad spectrum of antiviral activity against several members of the Bunyaviridae family.
23376165 Although their inhibitory activities were modest when compared to that of tetherin, IFITMs, but not tetherin, directly reduced the expression of HIV-1 proteins including Gag, Vif and Nef.
23376165 HIV-1 gp41 interacts with IFITM1
22996292 This study defines IFITM1 as an interferon-stimulated gene effector with action against HCV entry.
22787204 Introduction of anti-miR-130a in hepatocytes increased IFITM1 expression. Hepatocytes stably expressing IFITM1 reduced HCV replication. Together, these results suggested that HCV infection of hepatocytes upregulates miR-130a.
22634173 IFITM1 knockdown in human alveolar-derived bone marrow stromal cells was associated with inhibition of Runx2 mRNA and protein expression.
22609115 The results suggest that the expression of IFITM1 controls the invasiveness and migration of gastric cancer.
21976647 Hepatitis C virus infection suppresses the upregulation of a subset of effector molecules, including ISG56 and IFITM1.
21253575 IFITM proteins differentially restrict the entry of a broad range of enveloped viruses, and modulate cellular tropism independently of viral receptor expression.
21177806 IFITM1, IFITM2, and IFITM3 inhibit HIV-1 replication through interfering with virus entry.
20838853 IFITM1 was expressed in the five human glioma cell lines, and its expressions were positively correlated with their tumorigenicity
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20428811 Activated IFITM1 is associated with Peutz-Jeghers syndrome polyps.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20220060 Data show that ULBP1, TFR2 and IFITM1 were associated with increased susceptibility to Vgamma9Vdelta2 T-cell cytotoxicity.
20099975 Down regulation of IFITM1 is associated with cervical squamous cell carcinoma.
20064371 Antiviral effect of IFITM family members on H1N1 influenza, West Nile virus, and Dengue virus
19499152 results revealed that the interaction between IFITM1 and CAV-1 could enhance the inhibitory effect of CAV-1 on ERK activation
19304549 The positive expression level of IFITM1 is associated with the progression of the carcinogenetic process in Peutz-Jeghers syndrome.
18829488 IFITM1 plays an important role for the invasion at the early stage of HNSCC progression
18202764 IFITM1 has a role in cellular sensitivity to CDDP in esophageal cancer
15808405 Overexpression of 9-27 leads to increased migration and invasiveness by suppressing natural killer cells in gastric cancer
15661263 IFITM1 expression profiling could be used for molecular classification of CML, which may also predict survival
12926988 LEU13 has a novel role different from that in the inhibition of cell proliferation, involved in IFNA-induced refractoriness of RSa cells to X rays

AA Sequence

MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVG      1 - 70
DVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY                    71 - 125
//

Text Mined References (55)

PMID Year Title
26897526 2016 Interferon-induced transmembrane protein 1 (IFITM1) overexpression enhances the aggressive phenotype of SUM149 inflammatory breast cancer cells in a signal transducer and activator of transcription 2 (STAT2)-dependent manner.
26354436 2015 The Interferon-induced Transmembrane Proteins, IFITM1, IFITM2, and IFITM3 Inhibit Hepatitis C Virus Entry.
26259513 2015 IFITM1 promotes the metastasis of human colorectal cancer via CAV-1.
25738301 2015 The C-terminal sequence of IFITM1 regulates its anti-HIV-1 activity.
25552713 2015 Human cytomegalovirus exploits interferon-induced transmembrane proteins to facilitate morphogenesis of the virion assembly compartment.
25464829 2014 IFITM proteins incorporated into HIV-1 virions impair viral fusion and spread.
25422070 2014 IFITM proteins are incorporated onto HIV-1 virion particles and negatively imprint their infectivity.
25105503 2014 A membrane topology model for human interferon inducible transmembrane protein 1.
24676393 2014 Aberrant DNA methylation in the IFITM1 promoter enhances the metastatic phenotype in an intraperitoneal xenograft model of human ovarian cancer.
24603679 2014 Interferon-induced transmembrane protein 1 regulates endothelial lumen formation during angiogenesis.
24209773 2014 Elevated viral restriction factor levels in cortical blood vessels in schizophrenia.
24120510 Identification of the polymorphisms in IFITM1 gene and their association in a Korean population with ulcerative colitis.
24072182 2014 Targeted development of specific biomarkers of endometrial stromal cell differentiation using bioinformatics: the IFITM1 model.
23720721 2013 IFITM-2 and IFITM-3 but not IFITM-1 restrict Rift Valley fever virus.
23376165 2013 Characteristics of IFITM, the newly identified IFN-inducible anti-HIV-1 family proteins.
23358889 2013 IFITM proteins restrict viral membrane hemifusion.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22996292 2013 IFITM1 is a tight junction protein that inhibits hepatitis C virus entry.
22787204 2012 Hepatitis C virus infection modulates expression of interferon stimulatory gene IFITM1 by upregulating miR-130A.
22634173 2012 IFITM1 increases osteogenesis through Runx2 in human alveolar-derived bone marrow stromal cells.
22609115 2012 Overexpression of IFITM1 has clinicopathologic effects on gastric cancer and is regulated by an epigenetic mechanism.
22479637 2012 IFITM proteins restrict antibody-dependent enhancement of dengue virus infection.
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
21976647 2011 ISG56 and IFITM1 proteins inhibit hepatitis C virus replication.
21269460 2011 Initial characterization of the human central proteome.
21253575 2011 Distinct patterns of IFITM-mediated restriction of filoviruses, SARS coronavirus, and influenza A virus.
21177806 2011 The IFITM proteins inhibit HIV-1 infection.
21166591 2011 The small interferon-induced transmembrane genes and proteins.
20838853 2011 Knockdown of interferon-induced transmembrane protein 1 (IFITM1) inhibits proliferation, migration, and invasion of glioma cells.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20428811 2010 Wnt signaling may be activated in a subset of Peutz-Jeghers syndrome polyps closely correlating to LKB1 expression.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20220060 2010 Identification of a panel of ten cell surface protein antigens associated with immunotargeting of leukemias and lymphomas by peripheral blood gammadelta T cells.
20099975 2010 Differential gene expression identified in Uigur women cervical squamous cell carcinoma by suppression subtractive hybridization.
20064371 2009 The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus.
19946888 2010 Defining the membrane proteome of NK cells.
19499152 2009 Binding of IFITM1 enhances the inhibiting effect of caveolin-1 on ERK activation.
19304549 2009 [Expression and significance of interferon-inducible transmembrane protein-1 gene in Peutz-Jeghers syndrome].
18829488 2008 IFN-induced transmembrane protein 1 promotes invasion at early stage of head and neck cancer progression.
18202764 2008 Selection of a novel drug-response predictor in esophageal cancer: a novel screening method using microarray and identification of IFITM1 as a potent marker gene of CDDP response.
16847454 2007 IFITM1 plays an essential role in the antiproliferative action of interferon-gamma.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15808405 2005 The interferon-inducible 9-27 gene modulates the susceptibility to natural killer cells and the invasiveness of gastric cancer cells.
15661263 2005 Expression of IFITM1 in chronic myeloid leukemia patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12926988 2003 Involvement of LEU13 in interferon-induced refractoriness of human RSa cells to cell killing by X rays.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7559564 1995 Expression cloning of an interferon-inducible 17-kDa membrane protein implicated in the control of cell growth.
6548414 1984 Transcriptional and posttranscriptional regulation of interferon-induced gene expression in human cells.
3935435 1985 Differential regulation of interferon-induced mRNAs and c-myc mRNA by alpha- and gamma-interferons.
2492664 1989 A single DNA response element can confer inducibility by both alpha- and gamma-interferons.
2398277 1990 TAPA-1, the target of an antiproliferative antibody, is associated on the cell surface with the Leu-13 antigen.
1383329 1992 The CD19/CD21 signal transducing complex of human B lymphocytes includes the target of antiproliferative antibody-1 and Leu-13 molecules.