Property Summary

NCBI Gene PubMed Count 34
PubMed Score 100.55
PubTator Score 212.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
systemic lupus erythematosus 1.900 1.3e-04
psoriasis 2.400 1.4e-12
cutaneous lupus erythematosus 3.400 1.4e-05
astrocytoma 1.100 3.7e-06
posterior fossa group A ependymoma 1.600 8.8e-04
glioblastoma 1.200 1.5e-02
group 4 medulloblastoma -2.300 1.9e-05
medulloblastoma, large-cell -2.800 3.9e-06
juvenile dermatomyositis 5.578 9.3e-26
Duchenne muscular dystrophy 1.351 1.8e-04
autosomal dominant Emery-Dreifuss muscul... 1.019 1.3e-02
primary pancreatic ductal adenocarcinoma 1.296 3.0e-02
lung cancer -2.100 3.0e-04
active Crohn's disease 3.084 1.2e-03
ulcerative colitis 2.600 1.8e-05
pancreatic cancer 1.300 2.2e-03
interstitial cystitis 1.200 1.2e-02
cystic fibrosis 2.000 4.8e-03
pediatric high grade glioma 1.200 3.1e-02
pilocytic astrocytoma 2.200 1.6e-06
primary Sjogren syndrome 2.600 1.0e-05
subependymal giant cell astrocytoma 2.605 1.1e-02
Breast cancer 1.500 2.0e-03
invasive ductal carcinoma 1.586 3.0e-02
nasopharyngeal carcinoma 2.100 8.4e-05
lung carcinoma -1.900 7.9e-15
breast carcinoma 1.100 1.8e-11

Synonym

Accession O14879 Q99634 Q9BSK7 IFIT-3
Symbols P60
IRG2
IFI60
IFIT4
ISG60
RIG-G
cig41
CIG-49
GARG-49

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (24)

PMID Text
26686474 results indicated that RIG-G level was high in maturated cells and low in blast cells, and suggested that RIG-G might play a role in the differentiation of bone marrow hemocytes in vivo
26116899 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1 and IFIT-3 expression.
25650658 The transcription factor SOX9, which is linked to regulation of hypoxia-related genes, was identified as a key mediator of upregulation of the oncogene IFIT3 and thereby sustaining a "pseudoinflammatory" cellular condition in pancreatic tumors.
25252956 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25170834 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
25131332 In cell models of dengue virus 2 infection, authors found that IFITM3 contributed to both the baseline and interferon-induced inhibition of virus entry.
24742347 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
24223959 protective roles of IFIT3 following IFN-alpha production in DV infection of human lung epithelial cells
23415865 these findings reveal for the first time the negative regulation of Rig-G on SCF-E3 ligase activities through disrupting CSN complex, not only contributing to further investigation on biological functions of Rig-G, but also leading to better understanding of the CSN complex as a potential target in tumor diagnosis and treatment.
23333304 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
22647704 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells
22490698 RIG-G gene expression is closely correlated with the cross-talk between all-trans retinoic acid and IFN-alpha-induced signaling pathways in NB4 tumor cells.
21813773 our study characterizes IFIT3 as an important modulator in innate immunity
21056555 concluded that the expression of RIG-G was independent on the classical JAK-STAT pathway, but could be greatly increased by it.
20686046 Identification of alpha interferon-induced genes associated with antiviral activity in Daudi cells and characterization of IFIT3 as a novel antiviral gene.
20533260 transcription factors for the reporter gene. CONCLUSION: Both ISRE I and ISRE II on the RIG-G promoter are the binding sites for the complex of transcription factors. They are required for RIG-G expression, and ISRE I has a preferential role over ISRE II.
20403236 The complex STAT2/IRF-9 is the key factor mediating the expression of RIG-G gene regulated by IFN-alpha.
20137113 All-trans retinoic acid upregulated RIG-G in NB4 cells by upregulating IRF1, IRF9 and STAT2.
19351818 Induction of RIG-G by retinoic acid in NB4 cells resulted, to some extent, from an IFNalpha autocrine pathway, a finding that suggests a novel mechanism for the signal cross-talk between IFNalpha and retinoic acid.
18706081 IFIT4 may play roles in promoting monocyte differentiation into dendritic cell-like cells (DCLCs) and in directing DCLCs to modulate T-helper-1 cell differentiation, thus contributing to the autoimmunity and pathogenesis of systemic lupus erythematosus.
17933493 The induction of IFIT4 transcription by IFN-alpha depends upon sequential activation of PKCdelta, JNK and STAT1, and the influence of PKCdelta or JNK on IFN-alpha-mediated induction of IFIT4 is dependent upon the phosphorylation of STAT1 at Ser-727.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12539042 HIV-1 Vpr upregulates the gene expression of IFIT3 in human monocyte-derived dendritic cells

AA Sequence

MSEVTKNSLEKILPQLKCHFTWNLFKEDSVSRDLEDRVCNQIEFLNTEFKATMYNLLAYIKHLDGNNEAA      1 - 70
LECLRQAEELIQQEHADQAEIRSLVTWGNYAWVYYHLGRLSDAQIYVDKVKQTCKKFSNPYSIEYSELDC     71 - 140
EEGWTQLKCGRNERAKVCFEKALEEKPNNPEFSSGLAIAMYHLDNHPEKQFSTDVLKQAIELSPDNQYVK    141 - 210
VLLGLKLQKMNKEAEGEQFVEEALEKSPCQTDVLRSAAKFYRRKGDLDKAIELFQRVLESTPNNGYLYHQ    211 - 280
IGCCYKAKVRQMQNTGESEASGNKEMIEALKQYAMDYSNKALEKGLNPLNAYSDLAEFLETECYQTPFNK    281 - 350
EVPDAEKQQSHQRYCNLQKYNGKSEDTAVQHGLEGLSISKKSTDKEEIKDQPQNVSENLLPQNAPNYWYL    351 - 420
QGLIHKQNGDLLQAAKCYEKELGRLLRDAPSGIGSIFLSASELEDGSEEMGQGAVSSSPRELLSNSEQLN    421 - 490
//

Text Mined References (40)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26686474 2016 RIG-G inhibits the proliferation of NB4 cells and propels ATRA-induced differentiation of APL cells.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25650658 2015 Overexpression of IFN-induced protein with tetratricopeptide repeats 3 (IFIT3) in pancreatic cancer: cellular "pseudoinflammation" contributing to an aggressive phenotype.
25416956 2014 A proteome-scale map of the human interactome network.
25131332 2015 IFITM3-containing exosome as a novel mediator for anti-viral response in dengue virus infection.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24223959 2013 Protective roles of interferon-induced protein with tetratricopeptide repeats 3 (IFIT3) in dengue virus infection of human lung epithelial cells.
23415865 2013 Rig-G negatively regulates SCF-E3 ligase activities by disrupting the assembly of COP9 signalosome complex.
23237964 2013 The broad-spectrum antiviral functions of IFIT and IFITM proteins.
22490698 2012 [Role of auto-secreted interferon ? in all-trans retinoic acid-induced expression of RIG-G gene].
21813773 2011 IFN-induced TPR protein IFIT3 potentiates antiviral signaling by bridging MAVS and TBK1.
21642987 2011 IFIT1 is an antiviral protein that recognizes 5'-triphosphate RNA.
21269460 2011 Initial characterization of the human central proteome.
21190939 2011 The interferon stimulated gene 54 promotes apoptosis.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
21056555 2011 Intact JAK-STAT signaling pathway is a prerequisite for STAT1 to reinforce the expression of RIG-G gene.
20950130 2011 The ISG56/IFIT1 gene family.
20686046 2010 Identification of alpha interferon-induced genes associated with antiviral activity in Daudi cells and characterization of IFIT3 as a novel antiviral gene.
20533260 2010 [Role of the interferon-stimulated response elements I/II in expression regulation of the retinoic acid induced gene G].
20403236 2010 [A novel molecular mechanism of interferon alpha-regulated expression of retinoic acid-induced gene G].
20137113 2010 [Regulation mechanism for rig-g gene expression induced by all-trans retinoic acid].
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19351818 2009 IRF-9/STAT2 [corrected] functional interaction drives retinoic acid-induced gene G expression independently of STAT1.
18706081 2008 Interferon-induced protein IFIT4 is associated with systemic lupus erythematosus and promotes differentiation of monocytes into dendritic cell-like cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17933493 2008 Sequential activation of protein kinase C delta and JNK is required for interferon-alpha-induced expression of IFIT4.
17050680 2006 RIG-G as a key mediator of the antiproliferative activity of interferon-related pathways through enhancing p21 and p27 proteins.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9828129 1998 IFI60/ISG60/IFIT4, a new member of the human IFI54/IFIT2 family of interferon-stimulated genes.
9391139 1997 Use of differential display analysis to assess the effect of human cytomegalovirus infection on the accumulation of cellular RNAs: induction of interferon-responsive RNAs.
9207104 1997 Cloning of a gene (RIG-G) associated with retinoic acid-induced differentiation of acute promyelocytic leukemia cells and representing a new member of a family of interferon-stimulated genes.