Property Summary

NCBI Gene PubMed Count 48
PubMed Score 85.70
PubTator Score 472.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
systemic lupus erythematosus 2.500 1.7e-04
malignant mesothelioma 3.000 1.1e-08
psoriasis 2.300 5.1e-03
cutaneous lupus erythematosus 4.100 1.6e-06
group 4 medulloblastoma -2.800 2.8e-08
cystic fibrosis 2.600 2.1e-03
medulloblastoma, large-cell -3.700 3.5e-06
juvenile dermatomyositis 3.566 3.0e-22
intraductal papillary-mucinous neoplasm ... 2.000 2.4e-02
lung cancer -3.100 5.2e-05
pancreatic cancer 1.400 3.4e-03
fibroadenoma -1.500 1.5e-02
Multiple Sclerosis 3.500 3.4e-03
lung adenocarcinoma -1.100 6.4e-08
primary Sjogren syndrome 2.600 1.4e-04
nasopharyngeal carcinoma 1.800 1.2e-02
Breast cancer 1.500 7.2e-03
ovarian cancer 2.800 2.3e-03
dermatomyositis 2.400 1.7e-02

Protein-protein Interaction (3)

Gene RIF (24)

PMID Text
26157117 IFIT1 is not a dominant restriction factor against three different families of negative-sense RNA viruses.
26116899 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1, and IFIT-3 expression.
25170834 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
24196705 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
24098121 The specificity of IFIT1 for 2'O-unmethylated RNA serves as potent antiviral mechanism against viruses lacking 2'O-methyltransferase activity and at the same time allows unperturbed progression of the antiviral program in infected cells.
23867918 Data show that interferon-induced proteins with tetratricopeptide repeats 1 and 2 (IFIT1 and IFIT2) contribute to the regulation of hepatitis B virus (HBV) replication, likely at both transcriptional and posttranscriptional steps.
23785202 Results indicate that miR-203 is an interferon-inducible miRNA that can negatively regulate a number of cellular mRNAs, including an interferon-stimulated gene target, IFIT1/ISG56, by destabilizing its mRNA transcript.
23684765 TLR4 signaling, induced by LPS, increases the expression of melanoma differentiation-associated gene 5 (MDA5) and interferon
23529855 protein expression is inhibited by hepatitis C virus
23363937 ISG56 may play a role in immune and inflammatory reactions induced by toll-like receptor 3 signaling in human mesangial cells.
23334420 crystal structures of human IFIT5, its complex with PPP-RNAs, and an amino-terminal fragment of IFIT1
23052390 Data suggested that PIV5 mRNAs are methylated at the 2'-hydroxyl group and that ISG56/IFIT1 inhibits the translation of PIV5 mRNA by some unrecognized mechanism. Also ISG56/IFIT1 is primarily responsible for the IFN-induced inhibition of PIV5.
22647704 HIV-1 Vpr upregulates the gene expression of IFIT1 in human monocyte-derived dendritic cells
21976647 Hepatitis C virus infection suppresses the upregulation of a subset of effector molecules, including ISG56 and IFITM1.
21642987 IFIT1 bound PPP-RNA antagonizes viruses by sequestering specific viral nucleic acids.
21612406 ISG56 interacts with ribosomal protein L15 in gastric cancer cells.
21129252 Expression of ifi56 is enhanced significantly when the differentiation of APL cells was induced by all-trans retinoic acid.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
19416887 ISG56 is a mediator of negative-feedback regulation of virus-triggered induction of type I IFNs and cellular antiviral responses
19008854 The authors present evidence that P56 (ISG56 protein), the expression of which is strongly induced by IFN, double-stranded RNA and viruses, mediates the anti-HPV effect of IFN.
16973618 We observed that, although double-stranded RNA or Sendai virus infection induced the two genes with similar kinetics, their induction kinetics in response to interferon-beta were quite different.
16385451 Observational study of gene-disease association. (HuGE Navigator)
12708317 The expression of interferon-induced genes IFI-54K and IFI-56K in the infected cells was found to increase 50-100-fold

AA Sequence

MSTNGDDHQVKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEE      1 - 70
ALKSLKEAENLMQEEHDNQANVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPE     71 - 140
IDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAV    141 - 210
RLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKALQE    211 - 280
TPTSVLLHHQIGLCYKAQMIQIKEATKGQPRGQNREKLDKMIRSAIFHFESAVEKKPTFEVAHLDLARMY    281 - 350
IEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSIN    351 - 420
SLKKLVLRKLRRKALDLESLSLLGFVYKLEGNMNEALEYYERALRLAADFENSVRQGP                421 - 478
//

Text Mined References (53)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26157117 2015 Human and Murine IFIT1 Proteins Do Not Restrict Infection of Negative-Sense RNA Viruses of the Orthomyxoviridae, Bunyaviridae, and Filoviridae Families.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25416956 2014 A proteome-scale map of the human interactome network.
24098121 2013 Sequestration by IFIT1 impairs translation of 2'O-unmethylated capped RNA.
23867918 2014 Interferon-induced proteins with tetratricopeptide repeats 1 and 2 are cellular factors that limit hepatitis B virus replication.
23785202 2013 MicroRNA profiling of Sendai virus-infected A549 cells identifies miR-203 as an interferon-inducible regulator of IFIT1/ISG56.
23684765 2013 MDA5 and ISG56 mediate CXCL10 expression induced by toll-like receptor 4 activation in U373MG human astrocytoma cells.
23529855 2014 Hepatitis C virus impairs TLR3 signaling and inhibits IFN-? 1 expression in human hepatoma cell line.
23363937 2013 Interaction between interferon-stimulated gene 56 and melanoma differentiation-associated gene 5 in Toll-like receptor 3 signaling in normal human mesangial cells.
23334420 2013 Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
23237964 2013 The broad-spectrum antiviral functions of IFIT and IFITM proteins.
23052390 2013 ISG56/IFIT1 is primarily responsible for interferon-induced changes to patterns of parainfluenza virus type 5 transcription and protein synthesis.
21976647 2011 ISG56 and IFITM1 proteins inhibit hepatitis C virus replication.
21685951 2011 Where, in antiviral defense, does IFIT1 fit?
21642987 2011 IFIT1 is an antiviral protein that recognizes 5'-triphosphate RNA.
21612406 2011 A novel interaction between interferon-inducible protein p56 and ribosomal protein L15 in gastric cancer cells.
21269460 2011 Initial characterization of the human central proteome.
21190939 2011 The interferon stimulated gene 54 promotes apoptosis.
21129252 2010 [Expression of ifi56 gene in ATRA-induced APL cell differentiation and construction of ifi56 gene eukaryotic expression plasmid].
20950130 2011 The ISG56/IFIT1 gene family.
20926571 2010 The inhibitory action of P56 on select functions of E1 mediates interferon's effect on human papillomavirus DNA replication.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19416887 2009 ISG56 is a negative-feedback regulator of virus-triggered signaling and cellular antiviral response.
19244243 2009 Inducible deposition of the histone variant H3.3 in interferon-stimulated genes.
19008854 2008 Interferon-inducible protein, P56, inhibits HPV DNA replication by binding to the viral protein E1.
17969451 2007 The interferon-stimulated genes: targets of direct signaling by interferons, double-stranded RNA, and viruses.
17804510 2007 Hepatitis C virus infection induces the beta interferon signaling pathway in immortalized human hepatocytes.
16973618 2006 Distinct induction patterns and functions of two closely related interferon-inducible human genes, ISG54 and ISG56.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16023166 2005 Induction and mode of action of the viral stress-inducible murine proteins, P56 and P54.
16009940 2005 Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12777642 2003 Protein interaction for an interferon-inducible systemic lupus associated gene, IFIT1.
12708317 [Late activation of interferon-induced genes IFI-54k and IFI-56k in human RH cells infected with tick-borne encephalitis virus].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11152506 2001 Enhanced expression of interferon-regulated genes in the liver of patients with chronic hepatitis C virus infection: detection by suppression-subtractive hybridization.
11118224 2000 A new pathway of translational regulation mediated by eukaryotic initiation factor 3.
10950979 2000 Activation of cellular interferon-responsive genes after infection of human cells with herpes simplex virus type 1.
10662616 2000 Induction of the human protein P56 by interferon, double-stranded RNA, or virus infection.
10644362 2000 Characterization of the interaction between the interferon-induced protein P56 and the Int6 protein encoded by a locus of insertion of the mouse mammary tumor virus.
9826176 1998 Molecular cloning and characterization of two related and interferon-induced 56-kDa and 30-kDa proteins highly similar to 2'-5' oligoadenylate synthetase.
6186990 1983 Interferon-induced 56,000 Mr protein and its mRNA in human cells: molecular cloning and partial sequence of the cDNA.
3753936 1986 Molecular cloning, full-length sequence and preliminary characterization of a 56-kDa protein induced by human interferons.
3585080 1987 Chromosomal localization of the interferon-inducible human gene encoding mRNA 561.
3360121 1988 The IFI-56K and IFI-54K interferon-inducible human genes belong to the same gene family.
3175763 1988 Cloning and chromosomal location of human genes inducible by type I interferon.
3121313 1987 New inducers revealed by the promoter sequence analysis of two interferon-activated human genes.
1377167 1992 The interferon- and virus-inducible IFI-56K and IFI-54K genes are located on human chromosome 10 at bands q23-q24.