Property Summary

NCBI Gene PubMed Count 179
PubMed Score 384.30
PubTator Score 345.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Primary immunodeficiency disease 52 0.0 2.0
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
diabetes mellitus 1663 3.373 1.7

Expression

  Differential Expression (21)

Disease log2 FC p
psoriasis 1.700 3.8e-92
systemic lupus erythematosus 1.200 3.2e-03
malignant mesothelioma 1.200 4.6e-06
cutaneous lupus erythematosus 3.000 7.1e-06
glioblastoma 1.900 8.4e-05
posterior fossa group B ependymoma 2.300 8.0e-09
cystic fibrosis 1.400 5.3e-03
medulloblastoma, large-cell -1.700 3.7e-05
juvenile dermatomyositis 3.433 7.2e-18
tuberculosis 1.200 6.1e-03
intraductal papillary-mucinous neoplasm ... 1.300 2.5e-02
lung cancer -2.500 3.1e-04
active Crohn's disease 1.221 9.0e-03
Multiple Sclerosis 1.700 2.1e-02
pediatric high grade glioma 1.800 9.5e-06
group 4 medulloblastoma -1.100 3.5e-02
pilocytic astrocytoma 1.800 3.6e-06
primary Sjogren syndrome 1.900 2.4e-03
nasopharyngeal carcinoma 1.500 2.0e-04
lung carcinoma -1.600 6.2e-13
dermatomyositis 2.300 5.6e-03

 GO Component (2)

Protein-protein Interaction (5)

Gene RIF (171)

PMID Text
26782418 Our findings indicate that although STAT4 and IFIH1 SNPs are not associated with T1D in a Brazilian population, they might play a role in susceptibility to T1D on a larger worldwide scale
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26564103 MDA5 mediates neuroprotection against cerebral ischemic injury.
26485346 These results showed that mRNA levels of MDA5 and RIG-1 were significantly decreased and increased, respectively, in chronic hepatitis B patients when compared to healthy controls.
26437794 These results demonstrate that poliovirus infection actively suppresses the host type I interferon response by blocking activation of IRF-3 and suggests that this is not mediated by cleavage of MDA-5 or IPS-1.
26385483 discusses the different risk and protective IFIH1 alleles in the context of recent structural and functional analysis that relate to MDA5 regulation of interferon responses
26351918 The MDA5 knockdown had no significant impact on the phosphorylation of eukaryotic translation initiation factor 2alpha triggered by CCCP, and MDA5 itself was not recruited to SGs, and the regulation of MDA5 in the SG response occurs downstream of eIF2alpha.
26284909 Results describe a family with gain of function mutation associated with cutaneous manifestations of Aicardi-Goutieres and Singleton-Merten syndromes
26215161 The study proposes that the turnover kinetics of the ATPase domain enables the discrimination of self/non-self RNA by both RIG-I and MDA5.
26208481 Findings indicate that melanoma differentiation associated protein-5 (MDA5) may serve as a complementary role in the toll-like receptor3 (TLR3) activated suppression of neuroblastoma (NB).
26116899 HIV-1 Vpr upregulates the gene expression of IFIH1 in human monocyte-derived dendritic cells
25903820 A significantly higher frequency of anti-melanoma differentiation-associated gene 5 (MDA5) antibodies was observed in Chinese patients with polymyositis/dermatomyositis (PM/DM) than in Japanese patients.
25891073 Data indicate that pattern recognition receptors RIG-I and MDA5 displace viral proteins bound to dsRNA in an ATP-dependent manner.
25878102 These data demonstrate that EFTUD2 restricts Hepatitis C Virus infection mainly through an RIG-I/MDA5-mediated, JAK-STAT-independent pathway, thereby revealing the participation of EFTUD2 as a novel innate immune regulator.
25865883 the ectopic expression of RIOK3 or a phosphomimetic MDA5-S828D mutation attenuated MDA5-mediated signaling.
25850761 polymorphisms and clinical outcome of dengue virus infection
25794939 This review briefly summarizes the RLR system, and focuses on the relationship between LGP2 and MDA5, describing in detail how these two proteins work together to detect foreign RNA and generate a fully functional antiviral response.
25620204 A specific IFIH1 gain-of-function mutation causes Singleton-Merten syndrome.
25579795 As a receptor for viral RNA, MDA5 until now has been linked to antiviral host defense, but these novel studies show unexpected effects in antifungal immunity as well.
25515714 There is an association of the IFIH1 locus with susceptibility to type 1 diabetes mellitus in the Polish population.
25463548 MDA5 plays important role in sensing HCV infection to trigger interferon response.
25331610 Confirm the strong association between anti-MDA5 antibodies and cutaneous ulcers in dermatomyositis patients.
25288302 IFIH1 did not reveal significant single-SNP associations with multiple sclerosis risk.
25151986 Anti-MDA5 antibodies are not uncommon European patients with polymyositis/dermatomyositis.
25130193 significant role in the defense against hepatitis C virus
25127512 LGP2 and MDA5 work together to detect viral RNA and generate a complete antiviral response.
25042601 Single nucleotide polymorphism in IFIH1 gene is associated with type 1 diabetes.
24995871 study suggests that the IFIH1 mutations are responsible for the AGS phenotype due to an excessive production of type I interferon
24960033 Association of IFIH1 gene polymorphisms with dilated cardiomyopathy in a Chinese population
24886842 mRNA and corresponding protein expression of TLR3, TLR7, TLR9, RIG-I and MDA-5 were analyzed in nasal biopsies and various upper airway epithelial cell lines.
24829334 Experiments with paramyxovirus V protein-insensitive proteins revealed that the primary outcome of LGP2 interference is suppression of its ability to synergize with MDA5.
24800889 essential to prevent early degradation of IRF-3, thereby sustaining IRF-3-dependent antiviral innate immunity
24743923 findings suggest that RIG-I and MDA5 associate with AU-rich RNA species originating from the mRNA of the measles virus L gene.
24741583 These findings support the reliability of using commercially available recombinant MDA5 for detecting anti-MDA5 antibodies and confirm the association of these antibodies with RP-ILD in a large series of Mediterranean patients with DM.
24719229 Our study supports previous findings of an association between the rs1990760 polymorphism of IFIH1 and systemic lupus erythematosus and indicates that this SNP may also be associated with malar rash in lupus patients.
24701034 CXCL10 expression is induced by Hantaan virus infection through TLR3, RIG-I, and MDA-5 pathways correlated with the disease severity
24686847 Gain-of-function mutations in IFIH1 cause a spectrum of human disease phenotypes associated with upregulated type I interferon signaling, including Aicardi-Goutieres syndrome.
24621100 Data reports an association between the rs1990760 polymorphism in MDA5 and EV71 infection in children in China.
24550253 L region antisense RNA of EMCV is a key determinant of innate immunity to the virus and represents an RNA that activates LGP2 associated MDA5 in virally-infected cells.
24522921 MERS-CoV 4a protein interacted with PACT in an RNA-dependent manner but not with RIG-I or MDA5.
24402011 The IFIH1 gene appears to play a major role in the development of some autoimmune diseases, and it is, therefore, a candidate gene for T1DM.
24390337 MDA5 and MAVS cleavages are both mediated by coxsackievirus B3 2A protease.
24386202 The A allele of the rs1990760 polymorphism in the IFIH1 gene is associated with protection for arterial hypertension in type 1 diabetic patients.
24117221 we are unable to conclude whether the Thr946Ala SNP differentially affects IFIH1 function, at least in the context of IFN-alpha production in response to exposure to poly I:C.
24039580 RIG-I and MDA-5 detection of viral RNA-dependent RNA polymerase activity restricts positive-strand RNA virus replication.
23926323 Collectively, our in vitro and in vivo studies both support a critical role for MDA5 in the innate immune response against hepatitis B virus infection.
23734776 Meta-analysis demonstrates that the IFIH1 rs1990760 T-allele confers susceptibility to autoimmune diseases, suggesting that the IFIH1 rs1990760 polymorphism might have no effect on Graves' disease and Addison's disease.
23684765 TLR4 signaling, induced by LPS, increases the expression of melanoma differentiation-associated gene 5 (MDA5) and interferon (IFN)-stimulated gene 56 (ISG56) in U373MG human astrocytoma cells
23671710 Data show that LGP2 is able to synergize with melanoma differentiation associated gene-5 (mda-5) to render cells to induction by poly(I:C), but did not enhance retinoic acid-inducible gene-I (RIG-I) to induce type I interferon in response to poly(I:C).
23650567 Overexpression of the MDA5 protein reverses the suppression of IRF3 activation caused by EV71 infection.
23535865 three IFIH1 SNVs were associated with systemic lupus erythematosus.
23499489 Findings indicate that phosphatases PP1alpha and PP1gamma are key regulators of RIG-I and MDA5 antiviral signaling.
23441136 our results establish a distinct role for IFIH1 in apoptosis, inflammation, and autoantibody production, and explain the molecular basis of these three risk alleles for SLE pathogenesis.
23436757 The MDA-5 phenotype is frequently a clinical mimic of the antisynthetase syndrome and is not associated with rapidly progressive interstitial lung disease.
23390309 RAVER1 specifically regulates MDA5 activity, revealing a mechanism of differential regulation of MDA5- and RIG-I-mediated innate antiviral response.
23390110 Targeting of RIG-I and MDA5 could thus become a quintessential strategy to encounter heterogeneous cancers.
23284052 Depleting MDA5 with siRNA prevented IFNB production despite poly I:C stimulation. Induction of MDA5 upon stimulation was greater in IFNB-producing cells.
23273991 Study reports the crystal structure of MDA5 bound to double stranded RNA(dsRNA), which shows how, using the same domain architecture, MDA5 recognizes the internal duplex structure, whereas RIG-I recognizes the terminus of dsRNA.
23246693 No IFIH1 polymorphism showed statistically significant association with susceptibility to type 1 diabetes or other related autoimmune disorders in Brazilian patients.
23152520 These data show that MDA5 is essential to induce the interferon response after human metapneumovirus infection infection in human and mouse dendritic cells as well as in an experimental mouse model of infection.
23144876 The common IFIH1 single nucleotide polymorphism may modify the frequency of enterovirus RNA in blood of healthy children.
23108955 study represents the first report demonstrating an association of the IFIH1 rs1990760 polymorphism with systemic lupus erythematosus susceptibility in a Chinese population
23090998 MDA5 is a polymerization-dependent signaling platform that uses the amyloid-like self-propagating properties of mitochondrial antiviral-signaling protein to amplify signaling.
22915805 Overall, this indicates that RIG-I and MDA5 can both contribute to the recognition and control of Bluetongue virus infection.
22892369 MDA5 induced by polyinosinic-polycytidylic acid, in turn, increased the expression of a chemokine CXCL10.
22886382 HLA-DRB1*0101/*0405 is associated with susceptibility to anti-MDA-5 antibody-positive dermatomyositis in the Japanese population.
22864531 A TLR3-mediated upregulation of VEGF and its receptor subtype 2 (VEGF-R2) in human mesangial cells upon activation of viral receptors, is reported.
22797917 MDA5 is the key sensor for the dsRNA replicative intermediate form of positive sense ssRNA viruses.
22789000 The IFIH1 locus polymorphisms are unlikely to be associated with Addison's disease.
22732950 We present 2 cases of MDA-5-associated dermato-pulmonary syndrome and provide a comprehensive review of available literature. [review]
22705106 The CARD domains of MDA5 bind to K63 polyubiquitin & this binding is essential for MDA5 to activate the transcription factor IRF3.
22623778 Human respiratory syncytial virus nucleoprotein and inclusion bodies antagonize the innate immune response mediated by MDA5 and MAVS.
22590509 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22461656 MDA5 may be involved in innate immune reactions against H pylori and associate with glandular atrophy and intestinal metaplasia in patients with H pylori infection.
22301138 HSV-1 US11 binds to RIG-I and MDA-5 and inhibits their downstream signaling pathway.
22192091 Data show that the presence of autoantibodies against melanoma differentiation-associated gene 5 (MDA-5) in dermatomyositis (CADM) patients was inversely associated with the population of their city of residence.
22185736 the present study shows the presence of RIG-1,MDA-5, and LGP-2 in the human upper airways, most prominently inthe epithelium.
22160685 MDA5 cooperatively assembles into a filamentous oligomer composed of a repeating segmental arrangement of MDA5 dimers along the length of viral dsRNA.
22152027 IFIH1 affects several immune-related diseases, including psoriasis and chronic periodontitis.
22110759 type 1 diabetes-associated IFIH1 polymorphisms have no, or only minor influence on the occurrence, quantity or duration of enterovirus infection in the gut
22053898 IFIH1 rs3747517, but not rs1990760 polymorphism, plays an important role in type 1 diabetes risk in Chinese Han population.
22046141 Association analysis identified five SLE susceptibility genes reaching genome-wide levels of significance : NCF2 ,IKZF1 ,IRF8 ,IFIH1 , and TYK2
21978001 Data show that eosinophils expressed NOD1 and NOD2 mRNA and protein, low levels of RIG-I and MDA-5, and NLRP3 was completely absent.
21844166 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21705624 In patients with anti-double stranded DNA antibodies, an IFIH1 risk allele increases sensitivity to interferon-alpha signaling.
21496705 MDA5 expression may contribute to the proinflammatory circle in dermatomyositis andrelated autoimmune diseases.
21342182 NOD1, NOD2 and RIG-1/MDA-5 have a role in T-cell activation.
21289206 MDA5 was hyperexpressed in islet cells, including beta- and alpha-cells, in three autopsied pancreata obtained 2 to 5 days after onset of fulminant type 1 diabetes.
21270278 The findings indicate that IFIH1 genotypes influence progression from autoimmunity to diabetes development
21245912 Collectively, these data demonstrate that the intracellular RNA virus sensors (RIG-I, MDA5 and TLR3) are activated upon dengue virus infection and are essential for host defense against the virus.
21224721 The inflammatory response of rhinovirus infection in non-immune cells is mediated by MDA-5.
21187438 Laboratory of genetics and physiology (LGP)2 protein counterregulates signaling through RIG-I and MDA5 in rotavirus-infected intestinal epithelial cells.
21156324 These findings suggest that SUMO-1 modification of MDA5 possibly via PIAS2beta may play a role in the MDA5-mediated interferon response to viral infections.
21123378 Human parainfluenza virus type 1 C protein suppresses dsRNA intracellular accumulation and activation of MDA5 and PKR.
21113677 Both RIG-I and MDA5 were induced but neither of the two was essential for Dengue virus induced IFN-beta response.
21071089 These data suggested that the structural difference of vaccine measles virus V protein hampers MDA5 blockade and acts as a nidus for the spread/amplification of type I interferon induction.
21052763 Serum ferritin correlates with activity of anti-MDA5 antibody-associated acute interstitial lung disease as a complication of dermatomyositis.
20953190 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20844740 Reduced gene expression of IFIH1 is protective for type 1 diabetes.
20739519 MDA5, but not RIG-I, is the primary mediator of HSV recognition
20736039 genetic polymorphism is associated with risk of type 1 diabetes in a Russian population
20719949 define molecular determinants for MDA5 inhibition by the paramyxovirus V proteins
20694011 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20694011 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20668468 Compared to noncarriers, carriers of the 923Val and/or 460Arg variants were protected from psoriasis
20668468 Observational study of gene-disease association. (HuGE Navigator)
20647273 Observational study of gene-disease association. (HuGE Navigator)
20644636 The mechanism of the association of the nsSNP with T1D remains to be determined, but does not involve IFIH1 mRNA modulation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538742 These findings suggest that variants in IFIH1 confer different susceptibility to diverse viral infections.
20467774 The IFIH1 Ala946Thr polymorphism was not associated with susceptibility to systemic lupus erythematosus or dermatomyositis.
20467774 Observational study of gene-disease association. (HuGE Navigator)
20203524 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20116863 This study shows that the nsSNP rs35667974/Ile923Val does not have a role in susceptibility to MS.
20116863 Observational study of gene-disease association. (HuGE Navigator)
20033399 Observational study of gene-disease association. (HuGE Navigator)
19961590 our data suggest no contribution from IFIH1 rs1990760 polymorphism to the pathogenesis of either Graves' disease, Hashimoto's thyroiditis or Addison's disease in our study populations
19961590 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19951419 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19890046 TLR3 and MDA5, but not RIG-I, are required for maximal sensing of rhinovirus dsRNA and that TLR3 and MDA5 signal through a common downstream signaling intermediate, IRF3.
19846522 RIG-I and MDA5 both contribute to the recognition of MV and the V protein promotes MV growth at least partly by inhibiting the MDA5-mediated IFN responses
19841890 An association between the Ala946Thr polymorphism of IFIH1 and type 1 diabetes susceptibility has been detected in European populations.
19841890 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19838195 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19797678 Data show that found that IFIH1, a susceptibility gene of type 1 diabetes, interacts with YES1, which plays a role in glucose transport.
19742420 Genetic polymorphism in IFIH1 gene does not confer susceptibility to autoimmune thyroid disease in the Japanese population.
19742420 Observational study of gene-disease association. (HuGE Navigator)
19620789 Proapoptotic signaling induced by RIG-I and MDA-5 results in type I interferon-independent apoptosis in human melanoma cells.
19615405 This review summarizes the discovery of cytoplasmic sensor MDA-5, how it recognizes nucleic acids, its signaling pathways leading to cytokine synthesis, and viral countermeasures that have evolved to antagonize MDA-5 function.
19565506 RNA helicase encoded by MDA-5 is a critical molecule involved in innate immune defense against viruses. Viral infection may play a role in the pathogenesis of clinically amyopathic dermatomyositis and rapidly progressive interstitial lung disease.
19539001 no association of genetic polymorphism with type i diabetes in the Belgian population
19539001 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19531363 the structural basis of dsRNA recognition by MDA5 protein
19450885 association between two non-synonymous SNPs (rs1990760 and rs3747517) in the IFIH1 gene and multiple sclerosis in a large group of Danish patients.
19403670 The V protein interaction was found to disrupt ATP hydrolysis mediated by both MDA5 and LGP2.
19324880 Identification of loss of function mutations in human genes encoding RIG-I and MDA5: implications for resistance to type I diabetes.
19264985 study discovered 4 rare variants in IFIH1 that lowered type 1 diabetes risk independently of each other (odds ratio = 0.51 to 0.74; P = 1.3 x 10(-3) to 2.1 x 10(-16); variants are predicted to alter the expression and structure of IFIH1
19264985 Observational study of gene-disease association. (HuGE Navigator)
19211564 MDA5, RIG-I, and LGP2 have roles in regulating signal transduction
19164550 gC1qR is a physiological inhibitor of the RIG-I and MDA5-mediated antiviral signaling pathway
19156166 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients
19156166 Observational study of gene-disease association. (HuGE Navigator)
19154402 PIC-liposome could induce apoptosis and up-regulate cytoplasm receptors RIG-I and MDA5 in hepatoma cells
19073967 Observational study of gene-disease association. (HuGE Navigator)
19016379 Observational study of gene-disease association. (HuGE Navigator)
18927125 IFIH1 polymorphisms is associated with type 1 diabetes.
18927125 Observational study of gene-disease association. (HuGE Navigator)
18684960 Epidermal keratinocytes respond to viral double-stranded dsRNA equivalent poly(I:C) by expressing melanoma differentiation associated protein-5 (MDA-5) together with its signal pathway in an antiviral defense program targeting viral skin infections.
18285833 IFIH1 interferon induced helicase, GCA grancalcin or the potassium channel KCNH7 - are potential candidates implicated in the pathogenesis of multiple sclerosis.
18285833 Observational study of gene-disease association. (HuGE Navigator)
18071670 The reported type 1 diabetes association is from a linkage disequilibrium region including three candidate genes, FAP, IFIH1 and GCA.
18071670 Observational study of gene-disease association. (HuGE Navigator)
18026693 Observational study of gene-disease association. (HuGE Navigator)
18026693 An association of A946T polymorphism of the IFIH1 gene with the development of Graves' disease in a Chinese population was not apparent.
17541283 The putative dsRNA receptor MDA-5 may not play a pivotal role in the dsRNA-stimulated expression of inflammatory chemokines in airway epithelial cells.
17535987 Observational study of gene-disease association. (HuGE Navigator)
17535987 we confirm a significant contribution of the IFIH1 polymorphism to organ-specific autoimmune diseases, extending the range of conditions associated with this variant to include Graves' disease
17442111 Observational study of gene-disease association. (HuGE Navigator)
17442111 IFIH1 is upregulated in RA but that the A946T variant does not contribute significantly to the genetic background of RA
17267501 beginning at 4 h postinfection, MDA-5 protein is degraded in poliovirus-infected cells; poliovirus-induced cleavage of MDA-5 may be a mechanism to antagonize production of type I interferon in response to viral infection
16797201 In conclusion, our results show that in epithelial cells influenza A virus-induced antiviral cytokine gene expression is triggered by RIG-I and mda-5, whose expression is positively regulated by IFN-alpha.
16782388 results suggest that IFN-inducible mda-5 is involved in measles virus-induced expression of antiviral cytokines
16699517 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
16699517 report convincing statistical support for a sixth type 1 diabetes (T1D) locus in the innate immunity viral RNA receptor gene region IFIH1 (also known as mda-5 or Helicard) on chromosome 2q24.3
16575407 Rodent and human tumor cells containing constitutively activated Raf/Raf/MEK/ERK pathways were resistant to mda-5-induced killing.
16116171 Shared and unique functions of the DExD/H-box helicases RIG-I, MDA5, and LGP2 in antiviral innate immunity.
15563593 mda-5 plays a central role in an intracellular signal transduction pathway that can lead to the activation of the IFN-beta promoter, and that the V proteins of paramyxoviruses interact with mda-5 to block its activity.
14676839 mda-5 is a novel type I IFN-inducible gene, which may contribute to apoptosis induction during terminal differentiation and during IFN treatment
11805321 mda-5: An interferon-inducible putative RNA helicase with double-stranded RNA-dependent ATPase activity and melanoma growth-suppressive properties

AA Sequence

MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV      1 - 70
WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME     71 - 140
EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE    141 - 210
NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM    211 - 280
GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK    281 - 350
KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS    351 - 420
LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS    421 - 490
PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR    491 - 560
IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY    561 - 630
NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK    631 - 700
LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE    701 - 770
QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV    771 - 840
IEHETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNPSLITFLCKNC    841 - 910
SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP    911 - 980
CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDED                             981 - 1025
//

Text Mined References (189)

PMID Year Title
26782418 2015 Meta-analysis of STAT4 and IFIH1 polymorphisms in type 1 diabetes mellitus patients with autoimmune polyglandular syndrome type III.
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26564103 2016 Cytosolic Receptor Melanoma Differentiation-Associated Protein 5 Mediates Preconditioning-Induced Neuroprotection Against Cerebral Ischemic Injury.
26485346 2015 Are RIG-1 and MDA5 Expressions Associated with Chronic HBV Infection?
26437794 2015 Proteolysis of MDA5 and IPS-1 is not required for inhibition of the type I IFN response by poliovirus.
26385483 2015 Effects of type 1 diabetes-associated IFIH1 polymorphisms on MDA5 function and expression.
26351918 2016 Melanoma differentiation-associated gene 5 is involved in the induction of stress granules and autophagy by protonophore CCCP.
26284909 2015 Unusual cutaneous features associated with a heterozygous gain-of-function mutation in IFIH1: overlap between Aicardi-Goutières and Singleton-Merten syndromes.
26215161 2015 Kinetic discrimination of self/non-self RNA by the ATPase activity of RIG-I and MDA5.
26208481 2015 MDA5 complements TLR3 in suppression of neuroblastoma.
25903820 2015 Distinct profiles of myositis-specific autoantibodies in Chinese and Japanese patients with polymyositis/dermatomyositis.
25891073 2015 ATP-dependent effector-like functions of RIG-I-like receptors.
25878102 2015 EFTUD2 Is a Novel Innate Immune Regulator Restricting Hepatitis C Virus Infection through the RIG-I/MDA5 Pathway.
25865883 2015 RIOK3-mediated phosphorylation of MDA5 interferes with its assembly and attenuates the innate immune response.
25850761 2015 Polymorphisms in the retinoic acid-1 like-receptor family of genes and their association with clinical outcome of dengue virus infection.
25794939 2015 LGP2 synergy with MDA5 in RLR-mediated RNA recognition and antiviral signaling.
25620204 2015 A specific IFIH1 gain-of-function mutation causes Singleton-Merten syndrome.
25579795 2015 The RIG-I-like helicase receptor MDA5 (IFIH1) is involved in the host defense against Candida infections.
25515714 2015 Cumulative effect of IFIH1 variants and increased gene expression associated with type 1 diabetes.
25463548 2015 MDA5 plays a critical role in interferon response during hepatitis C virus infection.
25331610 2015 Cutaneous ulceration in dermatomyositis: association with anti-melanoma differentiation-associated gene 5 antibodies and interstitial lung disease.
25288302 2014 Analysis of polymorphisms in RIG-I-like receptor genes in German multiple sclerosis patients.
25151986 Prevalence and clinical significance of anti-MDA5 antibodies in European patients with polymyositis/dermatomyositis.
25130193 2015 Polymorphisms in melanoma differentiation-associated gene 5 link protein function to clearance of hepatitis C virus.
25127512 2014 The innate immune sensor LGP2 activates antiviral signaling by regulating MDA5-RNA interaction and filament assembly.
25042601 2015 Association analysis of PTPN22, CTLA4 and IFIH1 genes with type 1 diabetes in Colombian families.
24995871 2014 Aicardi-Goutières syndrome is caused by IFIH1 mutations.
24960033 2014 Association of innate immune IFIH1 gene polymorphisms with dilated cardiomyopathy in a Chinese population.
24886842 2014 Functional effects of Toll-like receptor (TLR)3, 7, 9, RIG-I and MDA-5 stimulation in nasal epithelial cells.
24829334 2014 Paramyxovirus V protein interaction with the antiviral sensor LGP2 disrupts MDA5 signaling enhancement but is not relevant to LGP2-mediated RLR signaling inhibition.
24800889 2014 Sustained activation of interferon regulatory factor 3 during infection by paramyxoviruses requires MDA5.
24743923 2014 In vivo ligands of MDA5 and RIG-I in measles virus-infected cells.
24741583 2014 Anti-MDA5 antibodies in a large Mediterranean population of adults with dermatomyositis.
24719229 2014 Genetic polymorphisms of dsRNA ligating pattern recognition receptors TLR3, MDA5, and RIG-I. Association with systemic lupus erythematosus and clinical phenotypes.
24701034 2014 Hantaan virus infection induces CXCL10 expression through TLR3, RIG-I, and MDA-5 pathways correlated with the disease severity.
24686847 2014 Gain-of-function mutations in IFIH1 cause a spectrum of human disease phenotypes associated with upregulated type I interferon signaling.
24621100 2014 A polymorphism in melanoma differentiation-associated gene 5 may be a risk factor for enterovirus 71 infection.
24550253 2014 Identification of an LGP2-associated MDA5 agonist in picornavirus-infected cells.
24522921 2014 Middle east respiratory syndrome coronavirus 4a protein is a double-stranded RNA-binding protein that suppresses PACT-induced activation of RIG-I and MDA5 in the innate antiviral response.
24402011 2013 The role of interferon induced with helicase C domain 1 (IFIH1) in the development of type 1 diabetes mellitus.
24390337 2014 Enterovirus 2Apro targets MDA5 and MAVS in infected cells.
24386202 2013 The A allele of the rs1990760 polymorphism in the IFIH1 gene is associated with protection for arterial hypertension in type 1 diabetic patients and with expression of this gene in human mononuclear cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24117221 2014 Functional characterization of the Thr946Ala SNP at the type 1 diabetes IFIH1 locus.
24039580 2013 RIG-I and MDA-5 detection of viral RNA-dependent RNA polymerase activity restricts positive-strand RNA virus replication.
23926323 2013 Melanoma differentiation-associated gene 5 senses hepatitis B virus and activates innate immune signaling to suppress virus replication.
23734776 2013 Association of IFIH1 rs1990760 polymorphism with susceptibility to autoimmune diseases: a meta-analysis.
23711367 2013 A role for the Ankyrin repeat containing protein Ankrd17 in Nod1- and Nod2-mediated inflammatory responses.
23684765 2013 MDA5 and ISG56 mediate CXCL10 expression induced by toll-like receptor 4 activation in U373MG human astrocytoma cells.
23671710 2013 LGP2 plays a critical role in sensitizing mda-5 to activation by double-stranded RNA.
23650567 2013 MDA5 plays a crucial role in enterovirus 71 RNA-mediated IRF3 activation.
23535865 2013 Contribution of IKBKE and IFIH1 gene variants to SLE susceptibility.
23499489 2013 Dephosphorylation of the RNA sensors RIG-I and MDA5 by the phosphatase PP1 is essential for innate immune signaling.
23441136 2013 Admixture mapping in lupus identifies multiple functional variants within IFIH1 associated with apoptosis, inflammation, and autoantibody production.
23436757 2013 Anti-melanoma differentiation-associated protein 5-associated dermatomyositis: expanding the clinical spectrum.
23390309 2013 RAVER1 is a coactivator of MDA5-mediated cellular antiviral response.
23390110 2013 Targeting the cytosolic innate immune receptors RIG-I and MDA5 effectively counteracts cancer cell heterogeneity in glioblastoma.
23284052 2013 Biphasic RLR-IFN-? response controls the balance between antiviral immunity and cell damage.
23273991 2013 Structural basis for dsRNA recognition, filament formation, and antiviral signal activation by MDA5.
23246693 2013 Interferon induced with helicase C domain 1 (IFIH1): trends on helicase domain and type 1 diabetes onset.
23152520 2013 Critical role of MDA5 in the interferon response induced by human metapneumovirus infection in dendritic cells and in vivo.
23144876 2012 Enterovirus RNA in peripheral blood may be associated with the variants of rs1990760, a common type 1 diabetes associated polymorphism in IFIH1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108955 2013 Association study of IFIH1 rs1990760 polymorphism with systemic lupus erythematosus in a Chinese population.
23090998 2012 MDA5 assembles into a polar helical filament on dsRNA.
22915805 2012 Sensing and control of bluetongue virus infection in epithelial cells via RIG-I and MDA5 helicases.
22908223 2012 Tetraspanin 6 (TSPAN6) negatively regulates retinoic acid-inducible gene I-like receptor-mediated immune signaling in a ubiquitination-dependent manner.
22892369 2012 Melanoma differentiation-associated gene 5 regulates the expression of a chemokine CXCL10 in human mesangial cells: implications for chronic inflammatory renal diseases.
22886382 2012 Brief report: Association of HLA-DRB1*0101/*0405 with susceptibility to anti-melanoma differentiation-associated gene 5 antibody-positive dermatomyositis in the Japanese population.
22864531 2012 Response of VEGF to activation of viral receptors and TNF? in human mesangial cells.
22797917 2012 Visualisation of direct interaction of MDA5 and the dsRNA replicative intermediate form of positive strand RNA viruses.
22789000 2013 Polymorphisms in the interferon-induced helicase (IFIH1) locus and susceptibility to Addison's disease.
22732950 2012 A novel dermato-pulmonary syndrome associated with MDA-5 antibodies: report of 2 cases and review of the literature.
22705106 2012 Ubiquitin-induced oligomerization of the RNA sensors RIG-I and MDA5 activates antiviral innate immune response.
22623778 2012 Human respiratory syncytial virus nucleoprotein and inclusion bodies antagonize the innate immune response mediated by MDA5 and MAVS.
22590509 2012 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22461656 2012 Expression of melanoma differentiation associated gene 5 is increased in human gastric mucosa infected with Helicobacter pylori.
22328336 2012 Ankrd17 positively regulates RIG-I-like receptor (RLR)-mediated immune signaling.
22301138 2012 Herpes simplex virus 1 tegument protein US11 downmodulates the RLR signaling pathway via direct interaction with RIG-I and MDA-5.
22192091 2011 Epidemiologic study of clinically amyopathic dermatomyositis and anti-melanoma differentiation-associated gene 5 antibodies in central Japan.
22185736 Retinoic acid-inducible gene 1-like receptors in the upper respiratory tract.
22160685 2011 Cooperative assembly and dynamic disassembly of MDA5 filaments for viral dsRNA recognition.
22152027 2012 Genetic variants in IFIH1 play opposite roles in the pathogenesis of psoriasis and chronic periodontitis.
22110759 2011 Polymorphisms in the innate immune IFIH1 gene, frequency of enterovirus in monthly fecal samples during infancy, and islet autoimmunity.
22053898 2012 IFIH1 gene polymorphisms in type 1 diabetes: genetic association analysis and genotype-phenotype correlation in Chinese Han population.
22046141 2011 Association of NCF2, IKZF1, IRF8, IFIH1, and TYK2 with systemic lupus erythematosus.
21978001 2011 NOD-like receptors and RIG-I-like receptors in human eosinophils: activation by NOD1 and NOD2 agonists.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21884169 2011 RIG-I-like receptors: cytoplasmic sensors for non-self RNA.
21844166 2011 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21791617 2011 DDX60, a DEXD/H box helicase, is a novel antiviral factor promoting RIG-I-like receptor-mediated signaling.
21742966 2011 Innate immune responses in human monocyte-derived dendritic cells are highly dependent on the size and the 5' phosphorylation of RNA molecules.
21705624 2011 Autoimmune disease risk variant of IFIH1 is associated with increased sensitivity to IFN-? and serologic autoimmunity in lupus patients.
21616437 2011 Immune signaling by RIG-I-like receptors.
21496705 2011 Enhanced skin expression of melanoma differentiation-associated gene 5 (MDA5) in dermatomyositis and related autoimmune diseases.
21342182 2011 Nucleotide-binding and oligomerization domain-like receptors and retinoic acid inducible gene-like receptors in human tonsillar T lymphocytes.
21289206 2011 RIG-I- and MDA5-initiated innate immunity linked with adaptive immunity accelerates beta-cell death in fulminant type 1 diabetes.
21270278 2011 An interferon-induced helicase (IFIH1) gene polymorphism associates with different rates of progression from autoimmunity to type 1 diabetes.
21269460 2011 Initial characterization of the human central proteome.
21245912 2011 RIG-I, MDA5 and TLR3 synergistically play an important role in restriction of dengue virus infection.
21245900 2011 2 methylate or not 2 methylate: viral evasion of the type I interferon response.
21224721 Human rhinovirus recognition in non-immune cells is mediated by Toll-like receptors and MDA-5, which trigger a synergetic pro-inflammatory immune response.
21217758 2011 Ribose 2'-O-methylation provides a molecular signature for the distinction of self and non-self mRNA dependent on the RNA sensor Mda5.
21187438 2011 RIG-I/MDA5/MAVS are required to signal a protective IFN response in rotavirus-infected intestinal epithelium.
21156324 2011 MDA5 is SUMOylated by PIAS2? in the upregulation of type I interferon signaling.
21123378 2011 The C proteins of human parainfluenza virus type 1 limit double-stranded RNA accumulation that would otherwise trigger activation of MDA5 and protein kinase R.
21113677 2011 Retinoic acid inducible gene-I and melanoma differentiation-associated gene 5 are induced but not essential for dengue virus induced type I interferon response.
21071089 2011 Strain-to-strain difference of V protein of measles virus affects MDA5-mediated IFN-?-inducing potential.
21052763 2011 Serum ferritin correlates with activity of anti-MDA5 antibody-associated acute interstitial lung disease as a complication of dermatomyositis.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20950133 2011 Retinoic acid-inducible gene-I-like receptors.
20844740 2010 Reduced expression of IFIH1 is protective for type 1 diabetes.
20739519 2010 Early innate recognition of herpes simplex virus in human primary macrophages is mediated via the MDA5/MAVS-dependent and MDA5/MAVS/RNA polymerase III-independent pathways.
20736039 2010 Loss-of-function mutations E6 27X and I923V of IFIH1 are associated with lower poly(I:C)-induced interferon-? production in peripheral blood mononuclear cells of type 1 diabetes patients.
20719949 2010 Dissociation of paramyxovirus interferon evasion activities: universal and virus-specific requirements for conserved V protein amino acids in MDA5 interference.
20694011 2010 Association of IFIH1 and other autoimmunity risk alleles with selective IgA deficiency.
20668468 2010 Carriers of rare missense variants in IFIH1 are protected from psoriasis.
20647273 2010 Investigation of type 1 diabetes and coeliac disease susceptibility loci for association with juvenile idiopathic arthritis.
20644636 2010 Study of transcriptional effects in Cis at the IFIH1 locus.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20538742 2010 Population genetics of IFIH1: ancient population structure, local selection, and implications for susceptibility to type 1 diabetes.
20467774 2010 Interferon-induced helicase (IFIH1) polymorphism with systemic lupus erythematosus and dermatomyositis/polymyositis.
20434986 2010 NLRC5 negatively regulates the NF-kappaB and type I interferon signaling pathways.
20368735 2010 The ubiquitin-specific protease 17 is involved in virus-triggered type I IFN signaling.
20203524 2010 Genetic susceptibility to type 2 diabetes is associated with reduced prostate cancer risk.
20116863 2010 No evidence of association of the rare nsSNP rs35667974 in IFIH1 with multiple sclerosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20033399 2010 Single-nucleotide polymorphisms in the IL2RA gene are associated with age at diagnosis in late-onset Finnish type 1 diabetes subjects.
20015976 2010 The RIG-I-like receptor IFIH1/MDA5 is a dermatomyositis-specific autoantigen identified by the anti-CADM-140 antibody.
19961590 2009 The rs1990760 polymorphism within the IFIH1 locus is not associated with Graves' disease, Hashimoto's thyroiditis and Addison's disease.
19951419 2009 Confirmation of the genetic association of CTLA4 and PTPN22 with ANCA-associated vasculitis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19890046 2009 Role of double-stranded RNA pattern recognition receptors in rhinovirus-induced airway epithelial cell responses.
19881509 2009 PCBP2 mediates degradation of the adaptor MAVS via the HECT ubiquitin ligase AIP4.
19846522 2010 Both RIG-I and MDA5 RNA helicases contribute to the induction of alpha/beta interferon in measles virus-infected human cells.
19841890 2010 The interferon-induced helicase IFIH1 Ala946Thr polymorphism is associated with type 1 diabetes in both the high-incidence Finnish and the medium-incidence Hungarian populations.
19838195 2009 A large-scale replication study identifies TNIP1, PRDM1, JAZF1, UHRF1BP1 and IL10 as risk loci for systemic lupus erythematosus.
19797678 2009 Coexpression network based on natural variation in human gene expression reveals gene interactions and functions.
19742420 2010 Genomic polymorphism in the interferon-induced helicase (IFIH1) gene does not confer susceptibility to autoimmune thyroid disease in the Japanese population.
19656871 2009 Activation of MDA5 requires higher-order RNA structures generated during virus infection.
19620789 2009 Proapoptotic signaling induced by RIG-I and MDA-5 results in type I interferon-independent apoptosis in human melanoma cells.
19615405 2009 Functions of the cytoplasmic RNA sensors RIG-I and MDA-5: key regulators of innate immunity.
19565506 2009 RNA helicase encoded by melanoma differentiation-associated gene 5 is a major autoantigen in patients with clinically amyopathic dermatomyositis: Association with rapidly progressive interstitial lung disease.
19539001 2009 IFIH1 gene polymorphisms in type 1 diabetes: genetic association analysis and genotype-phenotype correlation in the Belgian population.
19531363 2009 Structural basis of double-stranded RNA recognition by the RIG-I like receptor MDA5.
19450885 2009 Multiple sclerosis and polymorphisms of innate pattern recognition receptors TLR1-10, NOD1-2, DDX58, and IFIH1.
19430480 2009 Genome-wide association study and meta-analysis find that over 40 loci affect risk of type 1 diabetes.
19403670 2009 A shared interface mediates paramyxovirus interference with antiviral RNA helicases MDA5 and LGP2.
19380577 2009 Solution structures of cytosolic RNA sensor MDA5 and LGP2 C-terminal domains: identification of the RNA recognition loop in RIG-I-like receptors.
19324880 2009 Identification of loss of function mutations in human genes encoding RIG-I and MDA5: implications for resistance to type I diabetes.
19264985 2009 Rare variants of IFIH1, a gene implicated in antiviral responses, protect against type 1 diabetes.
19211564 2009 Regulation of signal transduction by enzymatically inactive antiviral RNA helicase proteins MDA5, RIG-I, and LGP2.
19164550 2009 Inhibition of RIG-I and MDA5-dependent antiviral response by gC1qR at mitochondria.
19156166 2009 IFIH1-GCA-KCNH7 locus is not associated with genetic susceptibility to multiple sclerosis in French patients.
19154402 2009 Polyinosinic-polycytidylic acid liposome induces human hepatoma cells apoptosis which correlates to the up-regulation of RIG-I like receptors.
19073967 2008 Shared and distinct genetic variants in type 1 diabetes and celiac disease.
19016379 2008 Association of toll-like receptor 3 gene polymorphism with subacute sclerosing panencephalitis.
18927125 2009 IFIH1 polymorphisms are significantly associated with type 1 diabetes and IFIH1 gene expression in peripheral blood mononuclear cells.
18684960 2008 Double-stranded RNA induces an antiviral defense status in epidermal keratinocytes through TLR3-, PKR-, and MDA5/RIG-I-mediated differential signaling.
18285833 2008 IFIH1-GCA-KCNH7 locus: influence on multiple sclerosis risk.
18071670 2008 The association between the IFIH1 locus and type 1 diabetes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18026693 2007 The A946T polymorphism in the interferon induced helicase gene does not confer susceptibility to Graves' disease in Chinese population.
17600090 2007 Negative regulation of MDA5- but not RIG-I-mediated innate antiviral signaling by the dihydroxyacetone kinase.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
17541283 2007 Role of RIG-I, MDA-5, and PKR on the expression of inflammatory chemokines induced by synthetic dsRNA in airway epithelial cells.
17535987 2007 Genomic polymorphism at the interferon-induced helicase (IFIH1) locus contributes to Graves' disease susceptibility.
17442111 2007 The interferon induced with helicase domain 1 A946T polymorphism is not associated with rheumatoid arthritis.
17267501 2007 MDA-5 is cleaved in poliovirus-infected cells.
17079289 2007 Inhibition of retinoic acid-inducible gene I-mediated induction of beta interferon by the NS1 protein of influenza A virus.
16797201 2006 Retinoic acid inducible gene-I and mda-5 are involved in influenza A virus-induced expression of antiviral cytokines.
16782388 2006 The interferon-inducible RNA helicase, mda-5, is involved in measles virus-induced expression of antiviral cytokines.
16699517 2006 A genome-wide association study of nonsynonymous SNPs identifies a type 1 diabetes locus in the interferon-induced helicase (IFIH1) region.
16575407 2006 Activation of Ras/Raf protects cells from melanoma differentiation-associated gene-5-induced apoptosis.
16177806 2005 Cardif is an adaptor protein in the RIG-I antiviral pathway and is targeted by hepatitis C virus.
16127453 2005 IPS-1, an adaptor triggering RIG-I- and Mda5-mediated type I interferon induction.
16116171 2005 Shared and unique functions of the DExD/H-box helicases RIG-I, MDA5, and LGP2 in antiviral innate immunity.
15563593 2004 The V proteins of paramyxoviruses bind the IFN-inducible RNA helicase, mda-5, and inhibit its activation of the IFN-beta promoter.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676839 2004 Expression analysis and genomic characterization of human melanoma differentiation associated gene-5, mda-5: a novel type I interferon-responsive apoptosis-inducing gene.
14645903 2003 A novel cellular RNA helicase, RH116, differentially regulates cell growth, programmed cell death and human immunodeficiency virus type 1 replication.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12015121 2002 Overexpression of Helicard, a CARD-containing helicase cleaved during apoptosis, accelerates DNA degradation.
11805321 2002 mda-5: An interferon-inducible putative RNA helicase with double-stranded RNA-dependent ATPase activity and melanoma growth-suppressive properties.
11002417 2000 Activation of the NF-kappaB pathway by caspase 8 and its homologs.