Property Summary

NCBI Gene PubMed Count 22
PubMed Score 16.69
PubTator Score 69.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease 3.445 6.0e-03
active ulcerative colitis 2.847 4.6e-03
Astrocytoma, Pilocytic 1.200 2.7e-02
Atopic dermatitis 1.500 1.0e-03
Breast cancer 2.500 4.8e-09
breast carcinoma 1.100 4.9e-02
cutaneous lupus erythematosus 3.100 3.5e-04
cystic fibrosis 1.207 6.8e-03
Duchenne muscular dystrophy 1.038 1.0e-07
group 4 medulloblastoma -1.300 7.5e-03
intraductal papillary-mucinous adenoma (... 1.600 8.5e-05
intraductal papillary-mucinous carcinoma... 1.700 5.5e-04
intraductal papillary-mucinous neoplasm ... 2.200 5.2e-04
invasive ductal carcinoma 2.100 8.6e-03
juvenile dermatomyositis 3.434 1.1e-15
lung cancer -1.600 3.6e-04
malignant mesothelioma 3.700 7.2e-09
medulloblastoma, large-cell -2.600 5.3e-05
Multiple myeloma 2.128 4.3e-04
Multiple Sclerosis 3.600 6.5e-04
osteosarcoma 3.546 1.7e-04
ovarian cancer 2.000 5.9e-03
pancreatic cancer 1.800 8.7e-05
posterior fossa group B ependymoma 1.300 1.2e-02
primary Sjogren syndrome 1.900 1.7e-02
psoriasis 3.400 4.0e-10
Systemic lupus erythematosus 2.100 1.3e-04
tuberculosis 1.700 5.9e-03

Gene RIF (13)

AA Sequence

MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANS      1 - 70
VAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE               71 - 130
//

Text Mined References (24)

PMID Year Title