Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.68
PubTator Score 356.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Anorexia nervosa 59 0.0 1.0
Bipolar Disorder 266 0.0 1.0
Disease Target Count Z-score Confidence
Hepatitis C 90 3.45 1.7

Expression

  Differential Expression (39)

Disease log2 FC p
systemic lupus erythematosus 1.900 1.0e-04
malignant mesothelioma 3.100 2.9e-08
astrocytoma 1.900 1.7e-02
ependymoma 1.500 9.4e-03
esophageal adenocarcinoma 1.200 4.5e-02
psoriasis 3.100 2.7e-108
cutaneous lupus erythematosus 3.200 2.5e-06
glioblastoma 2.600 1.4e-02
group 3 medulloblastoma 3.200 1.0e-06
cystic fibrosis 2.169 1.0e-04
atypical teratoid / rhabdoid tumor 1.100 1.8e-02
primitive neuroectodermal tumor 1.500 3.7e-02
Duchenne muscular dystrophy 1.023 1.9e-04
juvenile dermatomyositis 4.337 1.7e-23
Atopic dermatitis 1.100 1.7e-03
tuberculosis 1.300 2.8e-02
primary pancreatic ductal adenocarcinoma 1.053 5.2e-03
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.000 1.3e-03
X-linked cerebral adrenoleukodystrophy 1.300 3.3e-02
lung cancer -3.600 2.2e-06
active Crohn's disease 2.891 9.6e-04
ulcerative colitis 2.200 6.3e-05
pancreatic cancer 1.400 1.3e-03
Multiple Sclerosis 3.400 4.8e-03
interstitial cystitis 1.100 3.9e-02
adult high grade glioma 1.900 4.5e-05
pilocytic astrocytoma 2.000 4.2e-06
primary Sjogren syndrome 2.400 2.1e-05
subependymal giant cell astrocytoma 3.298 1.6e-02
invasive ductal carcinoma 1.633 3.2e-03
nasopharyngeal carcinoma 1.500 5.2e-03
inflammatory breast cancer 1.400 3.3e-02
lung carcinoma -2.700 4.4e-19
Pick disease -1.500 1.2e-02
progressive supranuclear palsy -2.100 1.3e-02
ovarian cancer 3.400 1.8e-05
pituitary cancer 2.900 2.2e-05
dermatomyositis 3.300 5.0e-04

Synonym

Accession Q8TCB0 B7ZAG3 D3DQ80 Q14496 p44
Symbols p44
TLDC5
MTAP44

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
25776761 IFI44 localizes to nuclei and suppresses HIV-1 LTR promoter.
24742347 HIV-1 and the viral protein Tat modulate the expression of interferon-inducible protein 44 (IFI44) in immature dendritic cells and monocyte-derived macrophages
22896602 The restriction of Bunyamwera virus replication mediated by interferon is an accumulated effect of at least three interferon-stimulated genes viperin, MTAP44 and PKR.
20237496 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of interferon-induced protein 44 (IFI44) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18953482 Observational study of gene-disease association. (HuGE Navigator)
17784819 Binds and depletes intracellular GTP, abolishing extracellular signal-regulated kinase (ERK) signaling and resulting finally in cell cycle arrest.
16886895 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12539042 HIV-1 and the viral protein Tat modulate the expression of interferon-inducible protein 44 (IFI44) in immature dendritic cells and monocyte-derived macrophages

AA Sequence

MAVTTRLTWLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQ      1 - 70
EGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCT     71 - 140
ISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVF    141 - 210
QGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQ    211 - 280
FNPMESIKLNHHDYIDSPSLKDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDS    281 - 350
MDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILSALRRMLWAADDF    351 - 420
LEDLPFEQIGNLREEIINCAQGKK                                                  421 - 444
//

Text Mined References (15)

PMID Year Title
25776761 2015 IFI44 suppresses HIV-1 LTR promoter activity and facilitates its latency.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22896602 2012 Viperin, MTAP44, and protein kinase R contribute to the interferon-induced inhibition of Bunyamwera Orthobunyavirus replication.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
18953482 2008 Polymorphisms of interferons and their receptors in the genetics of severe RSV-associated diseases.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17784819 2007 Antiproliferative activity of the human IFN-alpha-inducible protein IFI44.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16886895 2006 Genetic predisposition of responsiveness to therapy for chronic hepatitis C.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7925411 1994 Induction of the human gene for p44, a hepatitis-C-associated microtubular aggregate protein, by interferon-alpha/beta.