Property Summary

NCBI Gene PubMed Count 13
PubMed Score 12.07
PubTator Score 356.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Influenza, Human 51 0.0 0.0
Disease Target Count
Influenza 142
Spontaneous abortion 113
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.1
Bipolar Disorder 666 0.0 1.7

Expression

  Differential Expression (39)

Disease log2 FC p
active Crohn's disease 2.097 2.0e-03
active ulcerative colitis 2.134 1.1e-02
adult high grade glioma 1.900 4.5e-05
astrocytic glioma 1.800 1.0e-02
Astrocytoma, Pilocytic 2.000 3.6e-06
Atopic dermatitis 1.100 1.7e-03
atypical teratoid / rhabdoid tumor 1.100 1.8e-02
cutaneous lupus erythematosus 2.800 2.8e-06
cystic fibrosis 2.169 1.0e-04
dermatomyositis 1.800 2.7e-03
Duchenne muscular dystrophy 1.023 1.9e-04
ependymoma 1.500 9.4e-03
esophageal adenocarcinoma 1.200 4.5e-02
glioblastoma 1.800 7.1e-08
group 3 medulloblastoma 3.200 1.0e-06
inflammatory breast cancer 1.400 3.3e-02
interstitial cystitis 1.100 3.9e-02
intraductal papillary-mucinous adenoma (... 1.100 2.1e-02
intraductal papillary-mucinous neoplasm ... 3.000 1.3e-03
invasive ductal carcinoma 1.546 1.5e-03
juvenile dermatomyositis 1.797 4.0e-13
lung cancer -2.100 1.7e-03
lung carcinoma -2.700 4.4e-19
malignant mesothelioma 2.600 2.1e-07
Multiple Sclerosis 3.400 4.8e-03
nasopharyngeal carcinoma 1.500 5.2e-03
ovarian cancer 3.400 1.8e-05
pancreatic cancer 1.300 1.4e-03
Pick disease -1.100 3.5e-03
pituitary cancer 2.900 2.2e-05
primary pancreatic ductal adenocarcinoma 1.053 5.2e-03
primary Sjogren syndrome 1.600 4.3e-04
primitive neuroectodermal tumor 1.500 3.7e-02
progressive supranuclear palsy -1.200 4.7e-02
psoriasis 1.700 2.3e-05
subependymal giant cell astrocytoma 3.298 1.6e-02
Systemic lupus erythematosus 1.900 1.0e-04
tuberculosis 1.200 3.0e-02
X-linked cerebral adrenoleukodystrophy 1.300 3.3e-02

Gene RIF (9)

AA Sequence

MAVTTRLTWLHEKILQNHFGGKRLSLLYKGSVHGFRNGVLLDRCCNQGPTLTVIYSEDHIIGAYAEESYQ      1 - 70
EGKYASIILFALQDTKISEWKLGLCTPETLFCCDVTKYNSPTNFQIDGRNRKVIMDLKTMENLGLAQNCT     71 - 140
ISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGPIGAGKSSFFNSVRSVF    141 - 210
QGHVTHQALVGTNTTGISEKYRTYSIRDGKDGKYLPFILCDSLGLSEKEGGLCRDDIFYILNGNIRDRYQ    211 - 280
FNPMESIKLNHHDYIDSPSLKDRIHCVAFVFDASSIQYFSSQMIVKIKRIRRELVNAGVVHVALLTHVDS    281 - 350
MDLITKGDLIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILSALRRMLWAADDF    351 - 420
LEDLPFEQIGNLREEIINCAQGKK                                                  421 - 444
//

Text Mined References (15)

PMID Year Title