Property Summary

NCBI Gene PubMed Count 18
PubMed Score 141.37
PubTator Score 45.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

 MGI Phenotype (1)

 CSPA Cell Line (3)

Gene RIF (10)

PMID Text
26116226 The lysosomal thiol reductase GILT expressed by antigen-presenting cells has diverse cellular and organismal functions. (Review)
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of interferon, gamma-inducible protein 30 (IFI30) in primary human brain microvascular endothelial cells
23246037 this review discusses recent studies that have advanced our understanding of the role of GILT in antigen processing and revealed surprising new functions for the enzyme.[review]
21701784 Single nucleotide polymorphism of the interferon-gamma-inducible protein 30 gene is associated with hyperglycemia in severely obese individuals.
20668223 GILT is required for efficient histocompatiblity class II-restricted processing of melanoma antigen tyrosinase-related protein 1 epitope in vitro and accelerates the onset of vitiligo in TRP1-specific T-cell receptor transgenic mice.
19240061 Observational study of gene-disease association. (HuGE Navigator)
18410276 studied gene expression profile of brain lesions of a patient with Neuromyelitis optica by using DNA microarray; found marked up-regulation of interferon gamma-inducible protein 30 (IFI30), CD163, and secreted phosphoprotein 1 (SPP1, osteopontin)
18343923 GILT-expressing melanoma cells could prove to be very promising for direct antigen presentation and CD4+ T cell recognition
12198183 Role of the C-terminal propeptide in the activity and maturation of gamma -interferon-inducible lysosomal thiol reductase (GILT).
12021307 Absence of gamma-interferon-inducible lysosomal thiol reductase in melanomas disrupts T cell recognition of select immunodominant epitopes.

AA Sequence

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA      1 - 70
LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME     71 - 140
LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV    141 - 210
NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK                                  211 - 250
//

Text Mined References (24)

PMID Year Title
26116226 2015 Diverse cellular and organismal functions of the lysosomal thiol reductase GILT.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23246037 2013 Expanding roles for GILT in immunity.
21701784 2012 A polymorphism of the interferon-gamma-inducible protein 30 gene is associated with hyperglycemia in severely obese individuals.
21269460 2011 Initial characterization of the human central proteome.
20668223 2010 GILT accelerates autoimmunity to the melanoma antigen tyrosinase-related protein 1.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18410276 2008 Neuromyelitis optica/Devic's disease: gene expression profiling of brain lesions.
18343923 2008 Gamma-IFN-inducible-lysosomal thiol reductase modulates acidic proteases and HLA class II antigen processing in melanoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17142755 2006 Functional requirements for the lysosomal thiol reductase GILT in MHC class II-restricted antigen processing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12198183 2002 Role of the C-terminal propeptide in the activity and maturation of gamma -interferon-inducible lysosomal thiol reductase (GILT).
11491538 Multiple species express thiol oxidoreductases related to GILT.
10852914 2000 Gamma-interferon-inducible lysosomal thiol reductase (GILT). Maturation, activity, and mechanism of action.
10639150 2000 Enzymatic reduction of disulfide bonds in lysosomes: characterization of a gamma-interferon-inducible lysosomal thiol reductase (GILT).
3136170 1988 Molecular and biochemical characterization of a novel gamma-interferon-inducible protein.
1069150 1976 Letters to the editors.
16170 1977 [Endre Kótai; 1914-1976].