Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
subependymal giant cell astrocytoma 2287 1.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
subependymal giant cell astrocytoma 1.057 1.4e-02

Synonym

Accession Q9H2X8 Q8TBD7 Q9NYL0
Symbols TLH29
FAM14A
ISG12B

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MMKRAAAAAVGGALAVGAVPVVLSAMGFTGAGIAASSIAAKMMSAAAIANGGGVSAGSLVATLQSVGAAG      1 - 70
LSTSSNILLASVGSVLGACLGNSPSSSLPAEPEAKEDEARENVPQGEPPKPPLKSEKHEE               71 - 130
//

Text Mined References (4)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14728724 2004 Identification of a novel gene family that includes the interferon-inducible human genes 6-16 and ISG12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.