Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.5e-12
osteosarcoma 7933 7.3e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.416 7.3e-06
posterior fossa group B ependymoma 1.100 1.5e-12

Synonym

Accession Q96BM0
Symbols FAM14B
ISG12C

Gene

PDB

2LOQ  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGKESGWDSGRAAVAAVVGGVVAVGTVLVALSAMGFTSVGIAASSIAAKMMSTAAIANGGGVAAGSLVAI      1 - 70
LQSVGAAGLSVTSKVIGGFAGTALGAWLGSPPSS                                         71 - 104
//

Text Mined References (9)

PMID Year Title
22609626 2012 Facile backbone structure determination of human membrane proteins by NMR spectroscopy.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19260139 2009 Genome-wide association study of anthropometric traits in Korcula Island, Croatia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15014966 2004 Sequence organization and matrix attachment regions of the human serine protease inhibitor gene cluster at 14q32.1.
14728724 2004 Identification of a novel gene family that includes the interferon-inducible human genes 6-16 and ISG12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.