Property Summary

NCBI Gene PubMed Count 126
PubMed Score 112.66
PubTator Score 116.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2755 4.4e-27
juvenile dermatomyositis 1147 2.9e-16
glioblastoma 5635 2.1e-09
Duchenne muscular dystrophy 587 4.2e-09
Astrocytoma, Pilocytic 3006 1.2e-08
psoriasis 6514 2.1e-06
osteosarcoma 7766 1.0e-05
oligodendroglioma 2768 1.1e-05
ovarian cancer 8297 1.4e-05
acute quadriplegic myopathy 1133 1.3e-04
cystic fibrosis 1629 1.3e-04
adult high grade glioma 3701 1.6e-04
nephrosclerosis 314 2.4e-04
group 4 medulloblastoma 1806 2.5e-04
medulloblastoma, large-cell 6086 2.5e-04
Multiple myeloma 1296 5.4e-04
Breast cancer 3469 5.9e-04
posterior fossa group A ependymoma 456 6.8e-04
active Crohn's disease 882 7.7e-04
limb girdle muscular dystrophy 2A 208 8.1e-04
lung cancer 4607 1.2e-03
cutaneous lupus erythematosus 1016 3.1e-03
Becker muscular dystrophy 184 3.3e-03
dermatomyositis 941 3.5e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 492 4.8e-03
Systemic lupus erythematosus 191 5.8e-03
Multiple Sclerosis 527 6.1e-03
primary Sjogren syndrome 710 6.7e-03
aldosterone-producing adenoma 646 7.0e-03
pancreatic ductal adenocarcinoma liver metastasis 1911 8.0e-03
Down syndrome 480 8.6e-03
pancreatic cancer 2322 1.3e-02
lung adenocarcinoma 2627 1.3e-02
subependymal giant cell astrocytoma 2230 1.7e-02
Waldenstrons macroglobulinemia 742 1.8e-02
gastric carcinoma 781 1.9e-02
Pick disease 1856 2.0e-02
astrocytic glioma 2530 2.7e-02
active ulcerative colitis 736 2.7e-02
diabetes mellitus 1683 2.8e-02
intraductal papillary-mucinous adenoma (IPMA) 2872 2.8e-02
intraductal papillary-mucinous neoplasm (IPMN) 3204 3.1e-02
primitive neuroectodermal tumor 2957 4.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 1.0
Disease Target Count Z-score Confidence
Hypersensitivity reaction type II disease 245 0.0 1.8
Disease Target Count Z-score Confidence
Cancer 2388 3.03 1.5

Expression

  Differential Expression (43)

Disease log2 FC p
active Crohn's disease 3.147 7.7e-04
active ulcerative colitis 1.877 2.7e-02
acute quadriplegic myopathy 1.649 1.3e-04
adult high grade glioma 2.200 1.6e-04
aldosterone-producing adenoma -1.142 7.0e-03
astrocytic glioma 1.700 2.7e-02
Astrocytoma, Pilocytic 2.600 1.2e-08
autosomal dominant Emery-Dreifuss muscul... 1.426 4.8e-03
Becker muscular dystrophy 1.415 3.3e-03
Breast cancer -1.300 5.9e-04
cutaneous lupus erythematosus 1.100 3.1e-03
cystic fibrosis 1.201 1.3e-04
dermatomyositis 2.600 3.5e-03
diabetes mellitus -1.100 2.8e-02
Down syndrome 1.500 8.6e-03
Duchenne muscular dystrophy 2.259 4.2e-09
gastric carcinoma 1.200 1.9e-02
glioblastoma 2.300 2.1e-09
group 4 medulloblastoma -1.700 2.5e-04
intraductal papillary-mucinous adenoma (... 1.100 2.8e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.1e-02
juvenile dermatomyositis 2.884 2.9e-16
limb girdle muscular dystrophy 2A 1.190 8.1e-04
lung adenocarcinoma 1.142 1.3e-02
lung cancer -1.500 1.2e-03
lung carcinoma -2.300 4.4e-27
medulloblastoma, large-cell -2.200 2.5e-04
Multiple myeloma 2.176 5.4e-04
Multiple Sclerosis 1.100 6.1e-03
nephrosclerosis 1.051 2.4e-04
oligodendroglioma 1.300 1.1e-05
osteosarcoma 2.112 1.0e-05
ovarian cancer -3.000 1.4e-05
pancreatic cancer 1.100 1.3e-02
pancreatic ductal adenocarcinoma liver m... 1.253 8.0e-03
Pick disease 1.100 2.0e-02
posterior fossa group A ependymoma 1.200 6.8e-04
primary Sjogren syndrome 1.700 6.7e-03
primitive neuroectodermal tumor 1.500 4.5e-02
psoriasis 1.100 2.1e-06
subependymal giant cell astrocytoma 3.180 1.7e-02
Systemic lupus erythematosus 1.200 5.8e-03
Waldenstrons macroglobulinemia 1.451 1.8e-02

Gene RIF (100)

AA Sequence

MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFE      1 - 70
DIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPK     71 - 140
GSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVL    141 - 210
STTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVS    211 - 280
EAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQ    281 - 350
CHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT    351 - 420
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPS    421 - 490
TPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRL    491 - 560
KTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKII    561 - 630
AIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRG    631 - 700
EFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDI    701 - 770
LNPDSSMETSPDFFF                                                           771 - 785
//

Text Mined References (138)

PMID Year Title