Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.25
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
interstitial cystitis 1.100 6.6e-04
intraductal papillary-mucinous adenoma (... -1.200 4.0e-03
intraductal papillary-mucinous carcinoma... -1.100 4.8e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.5e-02
lung adenocarcinoma -1.184 4.0e-09
lung cancer -1.100 1.7e-02
medulloblastoma, large-cell -1.100 4.5e-04
non-small cell lung cancer -1.258 2.8e-14
ovarian cancer -1.500 1.8e-11
Pick disease -1.100 4.5e-05
psoriasis 1.200 4.9e-04
ulcerative colitis 1.200 1.1e-04

AA Sequence

MNPLFGPNLFLLQQEQQGLAGPLGDSLGGDHFAGGGDLPPAPLSPAGPAAYSPPGPGPAPPAAMALRNDL      1 - 70
GSNINVLKTLNLRFRCFLAKVHELERRNRLLEKQLQQALEEGKQGRRGLGRRDQAVQTGFVSPIRPLGLQ     71 - 140
LGARPAAVCSPSARVLGSPARSPAGPLAPSAASLSSSSTSTSTTYSSSARFMPGTIWSFSHARRLGPGLE    141 - 210
PTLVQGPGLSWVHPDGVGVQIDTITPEIRALYNVLAKVKRERDEYKRRWEEEYTVRIQLQDRVNELQEEA    211 - 280
QEADACQEELALKVEQLKAELVVFKGLMSNNLSELDTKIQEKAMKVDMDICRRIDITAKLCDVAQQRNCE    281 - 350
DMIQMFQVPSMGGRKRERKAAVEEDTSLSESEGPRQPDGDEEESTALSINEEMQRMLNQLREYDFEDDCD    351 - 420
SLTWEETEETLLLWEDFSGYAMAAAEAQGEQEDSLEKVIKDTESLFKTREKEYQETIDQIELELATAKND    421 - 490
MNRHLHEYMEMCSMKRGLDVQMETCRRLITQSGDRKSPAFTAVPLSDPPPPPSEAEDSDRDVSSDSSMR     491 - 559
//

Text Mined References (10)

PMID Year Title