Property Summary

NCBI Gene PubMed Count 64
PubMed Score 112.02
PubTator Score 88.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (44)

AA Sequence

MCHSRSCHPTMTILQAPTPAPSTIPGPRRGSGPEIFTFDPLPEPAAAPAGRPSASRGHRKRSRRVLYPRV      1 - 70
VRRQLPVEEPNPAKRLLFLLLTIVFCQILMAEEGVPAPLPPEDAPNAASLAPTPVSAVLEPFNLTSEPSD     71 - 140
YALDLSTFLQQHPAAF                                                          141 - 156
//

Text Mined References (67)

PMID Year Title