Property Summary

NCBI Gene PubMed Count 19
PubMed Score 82.24
PubTator Score 73.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
tuberculosis and treatment for 6 months 686 7.1e-06
Endometriosis 535 4.1e-02

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.200 7.1e-06
Endometriosis -1.595 4.1e-02

Gene RIF (16)

PMID Text
25541686 functional importance of IDO enzymes in human Crohn's disease
25394548 These results demonstrate that IDO2 plays a novel role as a negative regulator of IDO1 by competing for heme-binding with IDO1.
24875753 Human indoleamine 2,3-dioxygenase-2 has substrate specificity and inhibition characteristics distinct from those of indoleamine 2,3-dioxygenase-1
24858687 Multiple-scattering (MS) analysis of EXAFS data on met-indoleamine 2,3-dioxygenase-2 (IDO2) and analysis of XANES have provided the first direct structural information about the axial donor ligands of the iron center for this recently discovered protein.
24391212 IDO2 is expressed in both mDCs and plasmacytoid DCs and is not modulated by PGE2. IDO2 expression is constitutively, stably expressed in steady-state conditions and may contribute to the homeostatic tolerogenic capacity of DCs.
24105077 The IDO2 is now known to catalyze the first and rate-limiting step in the catabolism of tryptophan along a relative newcomer to the kynurenine pathway field.
23651343 Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease.
21835273 Purification and kinetic characterization of human indoleamine 2,3-dioxygenases 1 and 2 (IDO1 and IDO2) and discovery of selective IDO1 inhibitors.
21406395 Data show that IDO2-specific T cells are cytotoxic effector cells that recognize and kill tumor cells.
21084489 Tryptophan supplementation was able to completely restore hepatitis b virus replication in IFN-gamma- but not IFN-alpha-treated cells, which strongly argues that IDO is the primary mediator of IFN-gamma-elicited antiviral response in human hepatocytes.
19799997 The pro-apoptotic activity of indoleamine 2, 3-dioxygenase is responsible for its transcriptional regulation and the modulation of its pro-apoptotic activity during death receptor activation in melanoma cells.
19487973 High activity of indoleamine 2,3 dioxygenase enzyme predicts disease severity and case fatality in bacteremic patients.
19476837 Observational study of gene-disease association. (HuGE Navigator)
19476837 First study to report IDO2 expression in pancreatic ductal adenocarcinoma indicating that IDO2 genetic polymorphisms do not negate interferon-gamma-inducible protein expression.
17671174 IDO2 encodes a novel IDO-related tryptophan catabolic enzyme that is preferentially inhibited by D-1-methyl-tryptophan (D-1MT). IDO2 may have a distinct role in immune tolerance. Two common human genetic polymorphisms ablate IDO2 enzyme activity.
17499941 This article describes the evolutionary relationships between the INDO and INDOL1 genes. The INDOL1 protein has a distinct expression pattern compared to INDO and both have the ability to catabolise tryptophan.

AA Sequence

MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAH      1 - 70
QLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPI     71 - 140
LVHSDLVLTNWTKKDPDGFLEIGNLETIISFPGGESLHGFILVTALVEKEAVPGIKALVQATNAILQPNQ    141 - 210
EALLQALQRLRLSIQDITKTLGQMHDYVDPDIFYAGIRIFLSGWKDNPAMPAGLMYEGVSQEPLKYSGGS    211 - 280
AAQSTVLHAFDEFLGIRHSKESGDFLYRMRDYMPPSHKAFIEDIHSAPSLRDYILSSGQDHLLTAYNQCV    281 - 350
QALAELRSYHITMVTKYLITAAAKAKHGKPNHLPGPPQALKDRGTGGTAVMSFLKSVRDKTLESILHPRG    351 - 420
//

Text Mined References (25)

PMID Year Title
25950090 2015 Low efficiency IDO2 enzymes are conserved in lower vertebrates, whereas higher efficiency IDO1 enzymes are dispensable.
25691885 2015 Tryptophan-degrading enzymes in tumoral immune resistance.
25541686 2014 IDO1 and IDO2 non-synonymous gene variants: correlation with crohn's disease risk and clinical phenotype.
25477879 2014 IDO2 in Immunomodulation and Autoimmune Disease.
25394548 2014 Heme-binding-mediated negative regulation of the tryptophan metabolic enzyme indoleamine 2,3-dioxygenase 1 (IDO1) by IDO2.
24875753 2014 Human indoleamine 2,3-dioxygenase-2 has substrate specificity and inhibition characteristics distinct from those of indoleamine 2,3-dioxygenase-1.
24858687 2014 The Fe-heme structure of met-indoleamine 2,3-dioxygenase-2 determined by X-ray absorption fine structure.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24391212 2014 The SOCS3-independent expression of IDO2 supports the homeostatic generation of T regulatory cells by human dendritic cells.
24105077 2013 Indoleamine 2,3-dioxygenase 2 (IDO2) and the kynurenine pathway: characteristics and potential roles in health and disease.
23651343 2013 Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease.
21835273 2011 Purification and kinetic characterization of human indoleamine 2,3-dioxygenases 1 and 2 (IDO1 and IDO2) and discovery of selective IDO1 inhibitors.
21406395 2011 Spontaneous cytotoxic T-Cell reactivity against indoleamine 2,3-dioxygenase-2.
21084489 2011 Indoleamine 2,3-dioxygenase mediates the antiviral effect of gamma interferon against hepatitis B virus in human hepatocyte-derived cells.
19799997 2010 Induction of indoleamine 2, 3-dioxygenase by death receptor activation contributes to apoptosis of melanoma cells via mitochondrial damage-dependent ROS accumulation.
19487973 2010 High activity of indoleamine 2,3 dioxygenase enzyme predicts disease severity and case fatality in bacteremic patients.
19476837 2009 Genotyping and expression analysis of IDO2 in human pancreatic cancer: a novel, active target.
18418598 2009 IDO1 and IDO2 are expressed in human tumors: levo- but not dextro-1-methyl tryptophan inhibits tryptophan catabolism.
17671174 2007 Novel tryptophan catabolic enzyme IDO2 is the preferred biochemical target of the antitumor indoleamine 2,3-dioxygenase inhibitory compound D-1-methyl-tryptophan.
17499941 2007 Characterization of an indoleamine 2,3-dioxygenase-like protein found in humans and mice.
17430106 2007 The human indoleamine 2,3-dioxygenase gene and related human genes.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.