Property Summary

NCBI Gene PubMed Count 296
PubMed Score 330.06
PubTator Score 835.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus 3.900 7.1e-04
psoriasis 3.100 4.6e-119
juvenile dermatomyositis 1.041 1.6e-05
tuberculosis and treatment for 3 months -1.400 2.2e-04
lung cancer -2.900 2.2e-06
active Crohn's disease 2.833 5.3e-03
sarcoidosis 1.900 3.6e-02
interstitial cystitis 3.000 2.2e-02
cystic fibrosis 2.000 2.8e-05
primary Sjogren syndrome 1.200 7.1e-03
inflammatory breast cancer 1.400 2.0e-02
lung carcinoma -3.000 1.3e-11
invasive ductal carcinoma 1.400 1.9e-02
ulcerative colitis 5.000 6.0e-09
ovarian cancer 1.400 1.6e-02
head and neck cancer 3.600 2.6e-02

Protein-protein Interaction (2)

Gene RIF (279)

PMID Text
26647830 IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2
26608400 high expression in nasopharyngeal carcinoma patients correlates with lower survival rates
26563749 ISG15 is elevated in viremic HIV-1 patients and is associated with high TRAIL and IDO levels.
26511909 may play role in unexplained recurrent miscarriage
26511316 The data are consistent with a common reaction mechanism for indoleamine 2,3-dioxygenase-catalyzed oxidation of tryptophan and other tryptophan analogues.
26449488 Our results imply the probability of involvement of IDO in development of tolerance process, and we presume that high IDO activity is associated with nonresponsiveness to food allergens despite allergen sensitization.
26426076 Defective TLR9-mediated activation of IDO1 induction is associated with an inhibitor-positive status.
26361229 Indoleamine 2,3-Dioxygenase Is Involved in the Inflammation Response of Corneal Epithelial Cells to Aspergillus fumigatus Infections
26285873 IDO activity was significantly greater in HIV/AIDS patients than in healthy controls.
26267811 MT has potentiating effect in TGF-beta1-induced EMT, independently of IDO. This nonimmunological effect of MT should be considered if IDO is the target to avoid immune escape in bladder cancer
26198597 IDO1 expression and activity in LC seem to be involved in the pathophysiology of EH in AD and could represent a predictive biomarker for patients with risk to develop EH and other viral complications.
26186743 review of indoleamine 2,3-dioxygenase in health and disease [review]
26142400 Overexpression of IDO1 promoted immune modulatory activity, which was partly conveyed by IL-10.
26110930 IDO expression was increased in acute phase multiple sclerosis compared to patients in stable phase.
25899824 We conclude that autophagy, but not IDO and IFNgamma responsiveness, is dispensable for MSC's immunosuppressive properties. MSCs from CD subjects are functionally analogous to those of healthy individuals
25897671 Type I interferons, present in systemic lupus erythematosus sera patients, are able to up-regulate IDO expression, which may lead to decreased serum serotonin levels.
25886742 We found a definitive relation between IDO1 induction on acute myeloid leukemia blasts mediated by NK cell-produced IFNgamma and the consequent functional deregulation of NK cells that favors AML immune escape.
25792183 slows down viral replication during Hepatitis C infection; inhibits CD4-T cells proliferation
25783564 human amniotic fluid stem cells exhibited regulatory properties when treated with interferon (IFN)-gamma, including induction of the immunomodulatory enzyme indoleamine 2,3-dioxygenase 1
25756191 the role of IFN-lambda in IDO regulation was investigated after influenza infection of respiratory epithelial cells.
25683635 Results show low expression of Bin1, along with high expression of IDO, are predictor for poor prognosis in esophageal squamous cell cancer and thereby could be used to establish new therapeutic strategies.
25671592 Results suggest Withaferin A (WA) as a valuable small ligand molecule with strong binding affinity toward indoleamine 2,3-dioxygenase (IDO).
25627660 RSV can induce the expression and bioactivity of IDO in human moDC, in a virus replication-dependant fashion. We suggest that RSV activation of IDO could be a potential mechanism for the development of allergic diseases.
25584868 Cell-sorting experiments demonstrated that IDO1 expression is found in a subset of CD1a(+)CD14(-)langerin(+) cells, expressing CD103
25572287 IDO and tryptophan derivatives, particularly tranilast, can be tools for the therapy for lymphoid malignancies.
25541686 functional importance of IDO enzymes in human Crohn's disease
25461397 Data suggest that the tumor necrosis factor-alpha (TNF-alpha)/ transforming growth factor-beta (TGF-beta)/indoleamine 2,3-dioxygenase (IDO) axis may represent a new mechanism contributing to the development of tolerance in IVIg-treated patients.
25450809 IFN-gamma coordinately induces IDO1 and a tryptophan-selective transporter in human colonic epithelial cells and mouse dendritic cells with a positive feedback mechanism via kynurenine-AhR signaling.
25420916 Induction of IDO was mediated by the same TLR7-dependent recognition of B. burgdorferi RNA that contributes to the production of type I IFNs by human DCs.
25394548 These results demonstrate that IDO2 plays a novel role as a negative regulator of IDO1 by competing for heme-binding with IDO1.
25308308 In Helicobacter pylori-infected human gastric mucosa, an enhanced expression of IDO is capable of modulating Th1/Th2 and Th17 pathways
25283845 upregulated in choriodecidua following labor
25274283 elevation of MMP-9 and IDO induced by pancreatic cancer cells mediates NK cell dysfunction.
25248875 The expression of IDO mRNA was associated with a poor prognosis of AML.
25200149 Data indicate that the expression intensity of indoleamine 2, 3-dioxygenase (IDO) could modulate macrophage polarization in THP-1 cells.
25113564 In order to exert their protolerogenic function, fibrocytic myeloid-derived suppressor cells require direct contact with activated T cells, which leads to the production and secretion of IDO.
25081660 The results suggest that considering IDO and EGFR as two indicators for breast cancer treatment or prognosis analysis provides a potential option of individual treatment for the portion of breast cancer patients with co-expression of IDO and EGFR.
25063873 RelB-p52 dimers were found to directly bind to the IDO promoter, leading to IDO expression in MDSCs
25060643 Cancer/stroma interplay via cyclooxygenase-2 and indoleamine 2,3-dioxygenase promotes breast cancer progression.
25031694 through the activation of IL-33, the increased expression of IDO1 in ectopic endometrial stromal cells contributed to the truncated phagocytic ability of macrophages in endometriosis.
24988959 This is the first report of the interaction between IL-1Beta and IDO genes in schizophrenia.
24903009 These data indicate that IDO1 expression by leukemia blasts negatively affects the prognosis of childhood acute myeloid leukemia
24875753 Human indoleamine 2,3-dioxygenase-2 has substrate specificity and inhibition characteristics distinct from those of indoleamine 2,3-dioxygenase-1
24870595 Data show that the subsets of dendritic cells and memory T cells, and the indoleamine 2,3-dioxygenase (IDO) expression were correlated with each other with the tumor size, depth of invasion, lymph node metastasis, and clinical stage.
24795458 In the presence of S100A4 or UA, MSCs gained an immunosuppressive capability and stably induced IL-10- and IDO-expressing lymphocytes that maintained their phenotype following proliferation.
24742347 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
24742251 indoleamine 2,3-dioxygenase and infiltration of FOXP3+ regulatory T cells may have a role in aggressive characteristics of papillary thyroid microcarcinoma
24732701 Paradoxical upregulation of IDO expression in colon MNCs and ECs may represent a new predictive factor for prognosis in gut AGVHD after human allogeneic hematopoietic stem cell transplantation.
24721110 the expression intensity of IDO modulates macrophage differentiation
24717869 low activity is associated with asthma in Finnish population
24696473 Epstein-Barr virus infection induces IDO1 expression in macrophages through p38 and NF-kappaB pathways.
24687552 IDO was found in association with circulating breast cancer MV, while experimental and in silico gene expression revealed that IDO was mainly expressed in a triple-negative subgroup.
24612287 this study investigated whether oxygen tension influences dendritic cells expression of IDO in the context of homoeostatic and altered redox.
24517146 this study demonstrates a pivotal role of IDO1 in the suppression of lymphocyte function in thyroid carcinoma microenvironment.
24391212 IDO1 is expressed only in circulating myeloid DCs and is modulated by PGE2.It needs continuous transcription and translation. It provides an additional mechanism of tolerance induced by proinflammatory mediators.
24337170 Human cytomegalovirus efficiently blocks transcription of IFN-gamma-induced IDO mRNA both in infected fibroblasts.
24282429 Tregs and IDO-expressing cells are increased with regard to disease activity. These cells could significantly shape inflammatory bowel disease pathophysiology, severity, and tolerance loss.
24268989 IDO and CD83 are expressed differently in human epidermal Langerhans cells
24252613 Data indicate that the inhibitor of indoleamine 2,3-dioxygenase (IDO), 1-methyl tryptophan (MT), inhibited the effects of cytokine mixtures (CM) on small heat shock protein 27 (Hsp27).
24162774 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
24102581 IL-10 and IDO are involved in immunosuppression by human amniotic fluid stem cells.
24073214 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
23986400 Up-regulated expression of IDO and PD-L1, as well as recruitment of regulatoryT cells, in the tumor microenvironment depended on the presence of CD8(+) T cells.
23973990 IFN-gamma up-regulates COX-2 and IDO1 in HL-60 acute myeloid leukemia cells.
23949777 Forced IDO expression abolished the anti-apoptotic effect of umbilical cord-derived-mesenchymal stem cells on leukemia cells enhancing their proliferation-inhibitory effect on activated lymphocytes and leukemia cells.
23940074 antimicrobial functions are found to be species- and pathogen-specific
23898208 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
23853597 Data suggest that IDO1 and IL22 (interleukin-22) are crucial in balancing resistance/immunity with tolerance to Candida albicans in vaginal candidiasis (VC); genetic variants in IDO1 and IL22 are associated with heightened resistance to recurrent VC.
23847296 Decreased levels of IDO protein and mRNA in the placenta and decidua from recurrent spontaneous abortions patients suggest an important role for IDO in the maintenance of normal pregnancy.
23752227 The immunosuppressive role of IDO is to target immune checkpoints and provide a strong incentive to clinically explore combination therapies using IDO inhibitors irrespective of IDO expression by the tumor cells
23751345 study reports on the contribution of all the individual cysteine residues towards the overall catalytic properties, secondary structure, heme environment and stability of IDO1
23682557 Results show that expressions of indoleamine 2,3-dioxygenase 1 (IDO1) mRNA and protein were coincidentally higher in non-Hodgkin lymphoma tissues.
23669411 In human colon cancer cells, blockade of IDO1 activity reduced nuclear and activated b-catenin, transcription of its target genes (cyclin D1 and Axin2), and, ultimately, proliferation.
23651343 Indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase may play critical roles in the immune pathogenesis of chronic kidney disease.
23620105 the data provide proof-of-principle that immunisation with indoleamine 2,3-dioxygenase -silenced DC vaccine is safe and effective in inducing antitumour immunity.
23440412 Myeloid-derived suppressor cells suppress antitumor immune responses through IDO expression and correlate with lymph node metastasis in patients with breast cancer.
23426156 IDO is expressed more strongly in both primary and secondary glioblastoma tissue than low-grade glioma and may affect clinical outcome
23413147 decrease in activity could constitute a relevant biomarker for the restoration of the immune response during visceral leishmaniasis
23411497 Indoleamine 2,3-dioxygenase-1 (IDO1) enhances survival and invasiveness of endometrial stromal cells via the activation of JNK signaling pathway.
23358471 Freshly-resected meningiomas expressed both LAT1, the tryptophan transporter system and IDO, demonstrating an active kynurenine pathway. Dissociated meningioma cells lost IDO expression.
23344392 Indoleamine 2-3 dioxygenase (IDO1) is expressed in breast cancer tissue, as shown by immunohistochemistry. Expression is lower in ER- breast tumors with greater neoangiogenesis.
23289444 IDO plays an important role in the pregnancy-specific immune tolerance, and might be a contributing factor in the pathogenesis of pre-eclampsia.
23232072 These data suggest that IDO1 expression may contribute to immune suppression in patients with multiple myeloma and possibly other hepatocyte growth factor-producing cancers.
23209301 IDO has a novel function of catalyzing physiological peroxidase reactions.
23200754 Indoleamine 2,3 dioxygenase gene polymorphisms correlate with CD8+ Treg impairment in systemic sclerosis.
23179760 Tumoral indoleamine 2,3-dioxygenase express-ion predicts poor outcome in laryngeal squamous cell carcinoma.
23109825 Downregulation of CD4 expression by IDO was significantly attenuated by the addition of tryptophan or IDO inhibitor in the infected C8166 cells.
23090116 Systemic delivery of Salmonella typhimurium transformed with IDO shRNA enhances intratumoral vector colonization and suppresses tumor growth.
23025307 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
22936460 The upregulation of IDO1 in peripheral blood dendritic cells after maturation was significantly reduced in immune thrombocytopenia.
22932670 A critical role for IDO-mediated immunosuppression in glioma.
22929065 Data suggest that IDO activity may be a risk factor for future depression especially in women. IDO-induced alterations in serotonergic function may offer one biologic explanation to the well-established associations between inflammation and depression.
22923135 IDO downregulation enhanced the sensitivity of cervical cancer cells to natural killer cells in vitro and promoted NK cell accumulation in the tumor stroma in vivo.
22913669 Indoleamine 2,3-dioxygenase and prostaglandin E-2 are key modulators involved in the mesoangioblast suppression of T-cell proliferation.
22891315 IDO inserts oxygen into indole in a reaction that is mechanistically analogous to the "peroxide shunt" pathway of cytochrome P450.
22860140 Activation of IDO1 appeared to be a defensive mechanism downstream of IFN-gamma that limited intracellular expansion of Orientia tsutsugamushi via tryptophan depletion.
22828446 High IDO expression is associated with acute graft-versus-host disease.
22751107 observed elevated plasma IDO activity in patients with both pain and depression
22722711 Data indicate that indoleamine 2,3-dioxygenase (IDO) is expressed in primary MMCs to a low degree and is unlikely to play a direct major role in vivo in dampening antitumor immunity.
22690871 The cystine/glutamate antiporter regulates the functional expression of indoleamine 2,3-dioxygenase in human dendritic cells.
22638210 IDO1 is possibly involved in endometriosis pathogenesis via promoting COX-2 and MMP-9 expression and regulation of endometrial stromal cells biological characteristics
22592557 IDO1 activation represents a local compensatory mechanism to limit obesity-induced inflammation and hypertension.
22526360 The expression of indoleamine 2,3-dioxygenase in dendritic cells of immune thrombocytopenia patients was significantly decreased.
22519828 results show that cholera toxin per se does not induce the expression of functional IDO protein
22424783 zebularine plus interferon gamma induce IDO1 gene expression related to demethylation events in the IDO1 promoter region and to up-regulation of expression of transcription factors
22301793 although IDO is not required by MDM for the clearance of established viral infection, the spread of flavivirus infection is limited by IDO expressed in uninfected, neighboring cells.
22202241 expression of IDO did not correlate to histologic classification, tumor size, lymphatic invasion, venous invasion and lymph nodes metastasis, but it was correlated to clinical stage
22184722 T cells isolated from the hepatocellular carcinoma tissues expressed significantly more CD69 molecules than did those on paired circulating and nontumor-infiltrating T cells; these tumor-derived CD69(+) T cells could induce considerable IDO in monocytes
22112045 Indoleamine 2,3-dioxygenase expression and serum kynurenine concentrations in patients with diffuse large B-cell lymphoma.
22110525 upregulated expression in primary breast cancer correlates with increase of infiltrated regulatory T cells and lymph node metastasis
22093628 Expression of IDO is associated with clinical stage, lymph node metastasis, and microvessel density in breast cancer.
22069308 a novel role for interleukin-27 (IL-27) as mediator of intestinal epithelial barrier protection mediated via DMBT1 and IDO1
22039265 Data suggest a strong association of indoleamine 2,3-dioxygenase (IDO) activity with the severity and outcome of clinical graft-versus-host disease (GVHD).
22013481 high expression in esophageal squamous cell carcinoma correlates with impaired overall survival time
21980470 identification of a variable number of tandem repeats polymorphism in IDO1 promoter and characterization of LEF-1 response elements
21952237 ligation of TLR-3 by poly(I:C) induces IDO expression in human first-trimester trophoblasts via an IFN-beta-dependent pathway
21892828 The data suggest that IDO uses a ring-opening mechanism during N-formylkynurenine formation, rather than Criegee or dioxetane mechanisms as previously proposed.
21835273 Purification and kinetic characterization of human indoleamine 2,3-dioxygenases 1 and 2 (IDO1 and IDO2) and discovery of selective IDO1 inhibitors.
21835147 The proportion of CD4(+)IDO(+) T cells was significantly higher in patients with moderate GVHD.
21823214 High Indoleamine 2,3 dioxygenase-1 is associated with Crohn's disease.
21755000 A gradient of vascular endothelial IDO1 expression is present at both sides of the feto-maternal interface.
21742973 the ability of IDO-expressing tumor cells to thrive in a tryptophan-depleted microenvironment by expressing a novel, highly tryptophan-specific transporter, which is resistant to inhibition by most other amino acids
21712776 Somatization is characterized by increased IDO activity
21693183 Our results suggest no influence of the variants in the IDO gene and the diagnosis of interferon-alpha-related depression in the Brazilian population.
21692032 IDO expression in lower lip squamous cell carcinoma may aid immune escape and chronic inflammation to promote cancer progression.
21691274 The findings in Caucasians further support the notion that IDO has an important role in cytokine-induced behavioral changes.
21690092 trace amounts of peroxide previously proposed to occur in NADH solutions as well as solid NADH activate IDO and lead to aerobic formation of superoxide and the reactive dioxygen adduct of the enzyme.
21617756 It is possible that the substitution c.422+90G-->A; rs4613984 in an intron downstream to exon 4 of indoleamine 2, 3- dioxygenase (IDO) may be related with cataract formation among the aged.
21616522 indoleamine 2,3-dioxygenase expression seems to be an independent prognostic factor in patients with vulvar squamous cell carcinoma .
21600662 In women, IDO activity moderated the association between depressive symptoms and carotid intimamedia thickness (IMT), so that a longitudinal association between depressive symptoms and IMT was found only in combination with high IDO activity
21592112 data suggest that M. leprae chronic infection activates the suppressive molecule IDO which, in turn, contributes to the specific immunosuppression observed in lepromatous leprosy
21575365 Treatment with thymosin alpha1 downregulated TLR9 expression but upregulated IDO expression in a concentration- and time-dependent manner in aplastic anemia mesenchymal stem cells.
21517757 As it is comprehensively reviewed, IDO competence in human dendritic cells, in general, is induced by molecules such as interferon-gamma, which otherwise initiate immunity.
21517756 IDO is widely expressed in human tissues and cell subsets, including dendritic cells, where it modulates their function by increasing tolerogenic capacities.
21517755 The paper suggests that IDO may represent an important regulatory checkpoint influencing Regulatory T cells activity: both by stabilizing and augmenting the suppressive phenotype, and by preventing reprogramming into non-suppressive helper-like cells.
21517753 This review offers a survey of preclinical literature suggesting that IDO functions as a modifier of inflammatory states rather than simply as a suppressor of immune function.
21517752 This article reviews the interplay between indoleamine 2,3-dioxygenase 1 and cyclooxygenase (COX)-2 in chronic inflammation and cancer.
21502325 analysis of ferryl derivatives of human indoleamine 2,3-dioxygenase
21501890 in infectious, but also in noninfectious human cutaneous granulomas the large myeloid CD11c(+)S100(+)CD68(-) dendritic cells and the CD68(+) macrophages express IDO.
21487895 These results suggest that the activity of IDO enzyme is insufficient in immune thrombocytopenia patients.
21461581 IDO plays a key role in gastric cancer immune suppression, possibly by inhibiting T cell-mediated cytotoxicity and proliferation in vitro.
21461563 The intensity of IDO immunostaining was lower in the preeclamptic placentae than in the normal controls, and was related to the clinical severity of the preeclampsia.
21361337 Studies indicate that the heme dioxygenases are differentiated by their ability to catalyze the oxidation of l-tryptophan to N-formylkynurenine.
21359206 IFN-gamma inhibited proliferation and altered human and mouse MSC neural, adipocytic and osteocytic differentiation via the activation of IDO.
21355883 High IDO Dioxygenase is associated with acute graft-versus-host disease.
21328335 Loss of indoleamine 23-dioxygenase is associated with basal-like breast carcinoma.
21324164 Data suggest an inflammatory response characterized by indoleamine 2,3-dioxygenase activation may be relevant to the development of post-stroke cognitive impairment.
21292009 Compared to healthy volunteers, IDO concentration was twice as high in hemodialysis patients, which contributed to inadequate immune response to HBV vaccination.
21176371 Thymosin alpha1 can up-regulate the expression of ido mRNA in bone marrow mesenchymal stem cells from children with aplastic anemia.
21118329 [review] Induction of indoleamine 2, 3-dioxygenase and quinolinic acid mediates seizure activity in multiple sclerosis at least in part via an increase in interferon (IFN)gamma.
21094802 Patients receiving belatacept showed greater amounts of peripheral blood CD16+/IDO+ cells and Tregs on graft biopsies than those under cyclosporine treatment.
21030093 study concludes that there is no association between INDO polymorphisms and susceptibility of Iranian women to recurrent spontaneous abortion
21030093 Observational study of gene-disease association. (HuGE Navigator)
21028817 Binding of CO to l-Trp-bound IDO causes a significant change in the electronic and RR spectra of the heme, indicating that the pi* orbitals of the carbon atom of CO interact with pi orbitals of Fe and the porphyrin
20938662 Data suggest that indoleamine 2,3-dioxygenase (IDO) activity might play a role in diffuse large B-cell lymphoma and cells that express IDO appear important for determining outcomes after R-CHOP treatment.
20801903 Data identify indoleamine 2,3-dioxygenase-mediated catabolism as a tolerogenic mechanism exerted by leukemic dendritic cells and have clinical implications for the use of these cells for active immunotherapy of leukemia.
20689575 Psychological stress stimulates cytokine-driven IDO1 activation and Trp depletion which seems to have a central role for developing stress-induced immunosuppression and behavioral alteration.
20663292 Data show elevated levels of 3-HK modifications and the upstream, rate-limiting enzyme indoleamine 2,3-dioxygenase (IDO-1) in Alzheimer's diseased brains when compared to controls.
20648630 Data suggest that high expression of protein IMPACT homolog in non-immune cells acts as a protective mechanism against indoleamine 2,3-dioxygenase (IDO)-induced GCN2 activation, making them resistant to the amino acid-deprived environment caused by IDO.
20635895 Studies suggest that increased IDO activity may play an activating role in the autoimmune response.
20602605 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
20570568 In human chronic granulomatous disease (CGD)IDO metabolic activity is intact. Reactive oxygen intermediates apparently are dispensable for IDO activity. Thus, hyperinflammation in human CGD cannot be attributed to disabled IDO activation.
20522587 Human IDO transfected into composite three-dimensional islet grafts in mice, prolongs the islet allograft.
20484731 Postulate that induction of IDO may represent a critical initiating event that results in inversion of the T(H)17/T(reg) balance and in the consequent maintenance of a chronic inflammatory state in progressive HIV disease.
20386557 mediates immunosuppressive properties of umbilical cord-derived mesenchymal stem cells
20361220 subtle differences between the TDO and IDO reactions
20331378 Observational study of gene-disease association. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20192952 Variation "c.-147_150delGAAA" in the 5'-untranslated region of the IDO1 gene does not appear to be a primary cause of pre-eclampsia.
20192952 Observational study of gene-disease association. (HuGE Navigator)
20128646 The expression of IDO may in part explain retinal pigment epithelial mediated immune suppression effects.
19933867 Activated T cells can induce functional IDO expression in breast and kidney tumor cell lines. IDO is expressed in the majority of breast and kidney carcinoma samples, with infiltration of activated T helper type 1-polarized T cells in human tumors.
19929471 Dendritic cells polarizing culture conditions increased expression of IDO protein and IDO enzyme activity.
19844741 increased IDO expression in esophageal squamous cell carcinomas is from a mixed cellular source (both cancer cells and noncancerous cells)
19829303 IDO positive plasmacytoid dendritic cells are the classical BDCA2 positive cells in melanoma lymph nodes
19828629 IDO1-mediated tryptophan depletion induces transcriptional repressor B lymphocyte-induced maturation protein-1 (BLIMP-1) in U937 cells.
19815714 Results suggest that functional thymic indoleamine 2,3-dioxygenase-positive eosinophils during human infant life may have an immunomodulatory role in Th2 immune responses.
19783182 Plasma IDO activity does not reflect the degree of lung graft acceptance, but instead is correlated with the degree of chronic inflammation.
19740345 Inhibition of IDO expression with both classes of siRNAs inhibited dendritic cells immunosuppressive function on T-cell proliferation
19737010 Presented is evidence supporting the presence of an inhibitory substrate binding site in IDO that is capable of binding the substrates (L-Trp and 1-methyl-L-tryptophan), an effector (3-indole ethanol), and an uncompetitive inhibitor (Mitomycin C).
19695096 Data show that high density indoleamine 2,3-dioxygenase (IDO)+ cells exist in tumor-draining lymph nodes and that IDO is down-regulated in lymph nodes with metastases, implying that IDO in tumor and immune cells functions differently.
19693771 These results suggest that the activation of NF-kappaB through the PI3K-PKC-reactive oxygen species and PI3K-Akt pathways is required for the Hb-induced IDO expression in bone marrow dendritic cells.
19604349 Foxp3 and IDO expression is associated with sentinel lymph node metastases in breast cancer
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19597340 rhIDO significantly inhibited IL-2 expression in CHO cells. It decreased proliferative response & increased apoptosis in human T cells. IDO suppressed Vav1 mRNA & protein production in T cells. IDO inhibited TCR-activation-induced Vav1 phosphorylation.
19564344 impaired cytotoxic function seen in the IDO-treated CD8(+) T cells was accompanied by defects in production of granule cytotoxic proteins, including perforin and granzyme A and B
19514129 Identification of genetic variants in the human indoleamine 2,3-dioxygenase (IDO1) gene, which have altered enzyme activity
19489917 INDO showed significant associations with Aspirin-intolerant asthma.
19487045 These results suggest that increased IDO activity is involved in disease progression of lung cancer, possibly through its immunosuppressive effect.
19465693 priming of resting T cells with autologous, IDO-expressing, mature moDCs results in up to 10-fold expansion of CD4(+)CD25(bright)Foxp3(+)CD127(neg) Tregs.
19448397 These data support the notion that metastatic malignant melanoma cells select for expression of IDO to evade immunologic detection.
19434461 Imaging correlates of differential expression of IDO1 in brain neoplasms are reported.
19363598 Indoleamine 2,3-dioxygenase (IDO)-expression in antigen-presenting cells (APCs) may control autoimmune responses by depleting the available tryptophan, whereas tryptophanyl-tRNA synthetase (TTS) may counteract this effect
19353519 Induction of IDO1 by TLR involved an autocrine interferon (IFN)-beta signaling loop, which was dependent on protein kinase R
19306922 Elevation of intracellular iron levels during stimulation with IFNgamma impeded IFNgamma-induced IDO mRNA and protein expression.
19264674 Our results demonstrate that IDO plays an important role in the antiviral effect of IFN-gamma against DENV infection in vitro and suggest that it has a role in the immune response to DENV infections in vivo.
19168733 Role in the suppressive activity of intralesional Treg cells during acute and chronic cutaneous leishmaniasis due to Leishmania guyanensis.
19155537 IDO activity and serum levels of tryptophan catabolites of the kynurenine pathway increase with chronic kidney disease (CKD) severity. In CKD, induction of IDO may primarily be a consequence of chronic inflammation.
19106591 significance of indoleamine 2,3-dioxygenase (IDO) in recurrent breast cancer patients during chemotherapy
19074858 IDO is critically involved in tumor resistance to repeated treatments with IFNgamma-NGR, likely causing excessive stimulation of tryptophan catabolism and inhibiting antitumor immune mechanisms
19058839 House dust mite-sensitive DCs exposed to Der p 1 downregulated IDO activity and tipped the T(H)1/T(H)2 cytokine balance toward IL-4, resulting in sustainable IDO suppression.
19050070 determined INDO mRNA expression in leukemic blasts of 286 patients with acute myeloid leukemia by gene-expression profiling; high INDO expression is a strong negative independent predicting variable for overall and relapse-free survival
19010841 IDO overexpression in human cancer cells contributes to tumor progression in vivo with suppression of NK cells
19004406 Hydatidiform moles express IDO, but the majority of gestational trophoblastic tumors do not express this enzyme, suggesting that IDO-mediated immunoregulation is unlikely to be a major component of the malignant phenotype in these tumors.
18832696 IDO pathway is essential for PDC-driven Treg generation from CD4(+)CD25(-) T cells and implicate the generation of kynurenine pathway metabolites as the critical mediator of this process.
18802343 increased activity is associated with asymptomatic atopy during seasonal allergen exposure
18776940 differentiation of naive CD4+ T cells into Tregs with suppressive function was primarily dependent on plasmacytoid dendritic cell expression of indoleamine 2,3-dioxygenase
18660700 considerable potential for immunoregulation and antigen-specific tolerance induction in transplantation
18639339 In patients with acute myeloid leukemia (AML), the serum kynurenine/tryptophan ratio (Kyn/Trp) was raised, suggesting a higher IDO activity than in healthy people
18622801 IDO is a sensitive marker of atherosclerosis--or the inflammatory response associated with it--but does not have an independent role in the pathogenesis of this disease.
18438685 IDO may be a novel favorable prognostic indicator and candidate adjuvant therapeutic target for hepatocellular carcinoma.
18370410 reveal significant differences between the IDO and tryptophan 2,3-dioxygenase (TDO) enzymes, and the implications of these results are discussed in terms of our current understanding of IDO and TDO catalysis
18332894 transgenic expression of IDO in xenografts contributes to prolonged graft survival
18299324 Cytochrome b(5) rather than O(2)(*-) plays a major role in the activation of IDO in human cells.
18274832 are differences and similarities between biochemical behaviour and structural features of recombinant human IDO and recombinant mouse IDO
18205804 it is suggested that tryptophan depletion via IFN-gamma-mediated IDO induction is a major antibacterial, antiparasitic, antiviral and immunoregulatory mechanism in human lung cells.
18176870 We submit that an impaired IDO induction characterizes PBC (primary biliary cirrhosis)and might represent a contributing factor in disease pathogenesis in association with several specific defects in the target tissue
18055547 Type I IFN-mediated skin disorders, such as lichen planus , strongly express IDO in lesional skin.
18045970 Any possible antitumor effects of dextro-1-methyl tryptophan cannot be attributed to abrogation of IDO activity in dendritic cells.
18036645 The present study has demonstrated for the first time that baseline IDO enzymatic activity in induced sputum from asthmatic patients is very low compared with that seen in nonasthmatic control subjects and is inversely related to sputum eosinophilia.
18008147 The finding of this study revealed that the proliferation of CD8+ and CD4+ T cells are suppressed in response to tryptophan deficient environment caused by IDO expression and it is more so for CD8+ T than CD4+ T cells.
17951526 indoleamine 2,3-dioxygenase and prostaglandin E2 represent key mediators of the Mesenchymal stem cells-induced inhibition of NK cells
17911610 Interferon gamma-inducible expression of indoleamine 2,3-dioxygenase by human vascular smooth muscle cells inhibits allogeneic T cell activation, proliferation, and accumulation in vitro and in vivo.
17711549 Transfected into rats, reduces vascular permeability and leukocyte extravasation, and consequently improves graft function and histologic appearance.
17674321 The levels of intralesional expression of mRNA of tumor necrosis factor-alpha, interferon, interleukin-10, RANTES, and indoleamine-2,3-dioxygenase in Mediterranean spotted fever are reported; levels of inducible nitric oxide synthase are also reported.
17626075 poly(I:C)induction of IDO was mediated in part by IFN-beta but not IFN-gamma, and both NF-kappaB and interferon regulatory factor 3 (IRF3) were required.
17605849 Human acute monocyte leukemia and acute lymphocyte leukemia express indoleamine 2, 3-dioxygenase.
17535808 NO inhibits rhIDO activity reversibly by binding to the active site heme to trap the enzyme as an inactive nitrosyl-Fe(II) enzyme adduct with Trp bound and O2 displaced
17433037 IDO expression at the invasive front of cancer cells and APC, and the localization of Foxp3(+) Treg cells in front of cancer tissues, may create a network between IDO and Treg for the
17393386 Review discusses the immunoregulatory pathway of tryptophan catabolism initiated by indoleamine 2,3-dioxygenase (IDO) as a bidirectional feedback loop that could be part of an integrated response for preventing excessive inflammation and autoimmunity.
17376903 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
17321596 From the expression pattern we conclude that IDO may play a central role in human pregnancies for the establishment of maternal tolerance of fetal antigens
17318080 CD123/CCR6 dendritic cells (DCs) do not constitutively express IDO and "induced" IDO DCs
17294609 change in the clinical course of multiple sclerosis observed in pregnancy may be related to the estrogen-dendritic cell-IDO axis
17229698 Induction of IDO may dampen T-cell reactivity to viral antigens in chronic hepatitis C virus infection
17202379 TNF-alpha enhanced TLR ligand-induced IL-8 production in human gingival fibroblasts
17192467 IDO activation may protect islet cells from cytotoxic damage by interferon gamma.
17182891 hCG can upregulate human trophoblast indoleamine 2, 3-dioxygenase, which probably plays a key role at maternal fetal interface in preventing fetal rejection.
17170728 Acute myelocytic leukemia cells expresse INDO mRNA, but not IDO protein when exposed to optimal concentrations of IFN-gamma.
17158233 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
17038913 Recombinant antithymocyte globulin inhibits maturation of immature dendritic cells and llows the generation of dendritic cells expressing indoleamine 2,3-dioxygenase.
17015408 Sleeping beuaty-bsed human indoleamine 2,3-dioxygenase represents a new strategy for treating lung transplantation-associated chronic complications in rats.
16842443 reduced IDO activity found in the macrophages of patients with hepatitis C virus infection suggest the infection may hamper macrophage functions
16834326 These data provide the first glimpse of the possible regulatory mechanism of hIDO by NO and suggest that the NO-dependent regulation can be modulated by cellular factors, such as the NO abundance, pH, redox environment, and L-Trp availability.
16686756 The variable expression of IDO in different endothelial cells is important not only in understanding the role of endothelial cells in the regulation of graft rejection, but also as a potential therapeutic strategy.
16513157 Indoleamine 2,3-dioxygenase may have a role in the decline of T cell responses in immunosenescence
16511306 purification, crystallization and preliminary X-ray study of human IDO
16489067 IDO significantly contributes to disease progression and overall survival in patients with colorectal cancer.
16477023 X-ray crystal structure of human IDO, complexed with the ligand inhibitor 4-phenylimidazole and cyanide was reported.
16421220 CTLA-4 on regulatory T cells up-regulates IDO expression on decidual and peripheral blood dendritic cells and monocytes by the induction of IFN-gamma production.
16406698 examine the arguments for and against a function of IDO-expressing human dendritic cells (DCs) and conclude that proof for an immunoregulatory role in vivo is still lacking
16319139 HO-1/IDO cross-regulation modulates apoptosis and proliferation in rat and human breast cancer cells
16176799 In this review, the unique catalytic properties of indoleamine 2,3-dioxygenase are described, and the recent findings regarding the dioxygenase-initiated tryptophan metabolism are summarized.
16135011 A high T-helper type 1 (Th1)/Th2 cell ratio is more likely to cause loss of an allogeneic embryo in early pregnancy than is the loss of putative protection by reduced uterine levels of IDO.
15967116 Indoleamine 2,3-dioxygenase is expressed not by tumor cells, but by normal cells infiltrating the peritumoral stroma
15950064 the function of IDO and kynurenine hydroxylase may change from a role in immunosuppression at the maternal-fetal interface in early pregnancy, to one associated with regulation of fetoplacental blood flow or placental metabolism in late gestation
15947091 indoleamine 2,3 dioxygenase (IDO) activity is induced in a two-step process during dendritic cell maturation
15919929 IFN-gamma-induced enzyme IDO plays an important antiviral role in Measles Virus infections of epithelial, endothelial, and astroglial cells.
15711557 Findings indicate that attenuated Bin1 causes elevation of IDO and immune escape of cancers in mice. Additionally, small molecule inhibitors of IDO reverse the effects of Bin1 loss and leverage the efficacy of chemotherapeutic drugs in cancer.
15528322 IDO induction in eosinophils is a potential mechanism in the regulation of T helper type 2 (Th2) cell polarization.
15374002 HSV-2 antiviral effect of type II interferon and TNF-alpha is dependent on IDO activation.
15254595 Data suggest that indoleamine 2,3-dioxygenase-mediated suppression by plasmacytoid dendritic cells in tumor-draining lymph nodes creates a local microenvironment that is potently suppressive of host antitumor T cell responses.
15245429 stimulation with interferon-gamma (IFN-gamma) induces the expression of functionally active IDO in highly purified human epidermal Langerhans cells
15102781 RT4 cells were able to inhibit the growth of Staphylococcus aureus in an IDO-mediated fashion, and this bacteriostatic effect was abolished by endogenously produced NO.
15070879 despite suppression by progesterone, indoleamine 2,3-dioxygenase expression in endometrial stromal cells may increase during decidualization due to stimulation by interferon-gamma secreted by infiltrating leukocytes.
15001472 Bone marrow stromal cells express IDO protein and exhibit functional IDO activity upon stimulation with IFN-gamma.
14969766 Downregulation of MHC class I expression by Indoleamine 2,3-dioxygenase(IDO) might be one of the mechanisms through which IDO mediates local immunosuppression.
14871294 indoleamine 2,3-dioxygenase is necessary for cytolytic activity of natural killer cells.
14502282 Data show that most human tumors constitutively express indoleamine 2,3-dioxygenase (IDO), and that expression of IDO by immunogenic mouse tumor cells prevents their rejection by preimmunized mice.
13678429 characterization of regulatory sequences involved in the synergistic transcriptional activation of the indoleamine dioxygenase gene by interferon-gamma and tumor necrosis factor-alpha.
12963490 one important consequence of increasing IDO activity in astroglial cells during inflammation is to maintain NAD levels through de novo synthesis from tryptophan.
12938169 Data show that indoleamine 2,3-dioxygenase-expressing fibroblasts embedded within collagen gel suppress the proliferation of allogenic immune cells, while they still remain viable in a tryptophan-deficient culture environment.
12766158 Asp274 and his346 are essential for heme binding and catalytic function of human indoleamine 2,3-dioxygenase
12471139 Induction of IDO in airway epithelial-like tumor cells by exposure to IFN-gamma for 24 hr markedly amplifies IL-6 and IL-8 responses via depletion of tryptophan from the culture medium.
12444143 HIV-1 gp120 upregulates the expression of indoleamine-pyrrole 2,3 dioxygenase (INDO) in human B cells
12228717 describe a subset of human monocyte-derived dendritic cells that use IDO to inhibit T cell proliferation in vitro
12186837 inhibition of allogeneic T cell proliferation by indoleamine 2,3-dioxygenase-expressing dendritic cells: mediation of suppression by tryptophan metabolites
11987129 Data show that overexpression of indoleamine-2,3-dioxygenase is present in Crohn's disease as well as in ulcerative colitis, but nit in diverticulitis, as compared to normal mucosa.
11867636 heme environment--structural properties and substrate-ligand interactions

AA Sequence

MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHL      1 - 70
TDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPN     71 - 140
KPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKA    141 - 210
LQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQ    211 - 280
QTAGGGHAAQFLQDMRRYMPPAHRNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIV    281 - 350
TKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG                     351 - 403
//

Text Mined References (309)

PMID Year Title
26647830 2016 Indoleamine 2,3?dioxygenase downregulates T?cell receptor complex ??chain and c?Myc, and reduces proliferation, lactate dehydrogenase levels and mitochondrial glutaminase in human T?cells.
26608400 2016 Prognostic value of indoleamine 2,3-dioxygenase activity and expression in nasopharyngeal carcinoma.
26563749 2016 ISG15 expression correlates with HIV-1 viral load and with factors regulating T cell response.
26511909 2016 Role of Indoleamine 2,3-Dioxygenase and Tryptophan 2,3-Dioxygenase in Patients with Recurrent Miscarriage.
26511316 2015 Substrate Oxidation by Indoleamine 2,3-Dioxygenase: EVIDENCE FOR A COMMON REACTION MECHANISM.
26449488 2016 Low indoleamine 2,3-dioxygenase activity in persistent food allergy in children.
26426076 2015 IDO1 suppresses inhibitor development in hemophilia A treated with factor VIII.
26361229 2015 Indoleamine 2,3-Dioxygenase Is Involved in the Inflammation Response of Corneal Epithelial Cells to Aspergillus fumigatus Infections.
26285873 2015 The kynurenine pathway activities in a sub-Saharan HIV/AIDS population.
26267811 2015 1-Methyl-D-tryptophan potentiates TGF-?-induced epithelial-mesenchymal transition in T24 human bladder cancer cells.
26198597 2015 Exaggerated IDO1 expression and activity in Langerhans cells from patients with atopic dermatitis upon viral stimulation: a potential predictive biomarker for high risk of Eczema herpeticum.
26186743 2015 Role of indoleamine 2,3-dioxygenase in health and disease.
26155395 2015 Expression profile of the human IDO1 protein, a cancer drug target involved in tumoral immune resistance.
26142400 2015 Indoleamine 2,3-dioxygenase 1 in corneal endothelial cells limits herpes simplex virus type 1-induced acquired immune response.
26110930 2015 Indoleamine 2,3 Dioxygenase (IDO) Expression and Activity in Relapsing-Remitting Multiple Sclerosis.
25970480 2015 Challenges in the Discovery of Indoleamine 2,3-Dioxygenase 1 (IDO1) Inhibitors.
25950090 2015 Low efficiency IDO2 enzymes are conserved in lower vertebrates, whereas higher efficiency IDO1 enzymes are dispensable.
25899824 2015 Mesenchymal Stromal Cells Derived From Crohn's Patients Deploy Indoleamine 2,3-dioxygenase-mediated Immune Suppression, Independent of Autophagy.
25897671 2015 Type I interferon-mediated skewing of the serotonin synthesis is associated with severe disease in systemic lupus erythematosus.
25886742 2015 TIM-3/Gal-9 interaction induces IFN?-dependent IDO1 expression in acute myeloid leukemia blast cells.
25792183 2015 Antiviral and Immunoregulatory Effects of Indoleamine-2,3-Dioxygenase in Hepatitis C Virus Infection.
25783564 2015 Stem cells from human amniotic fluid exert immunoregulatory function via secreted indoleamine 2,3-dioxygenase1.
25756191 2015 Interferon Lambda Upregulates IDO1 Expression in Respiratory Epithelial Cells After Influenza Virus Infection.
25691885 2015 Tryptophan-degrading enzymes in tumoral immune resistance.
25683635 2015 Low expression of Bin1, along with high expression of IDO in tumor tissue and draining lymph nodes, are predictors of poor prognosis for esophageal squamous cell cancer patients.
25671592 2015 Molecular docking and dynamic simulation studies evidenced plausible immunotherapeutic anticancer property by Withaferin A targeting indoleamine 2,3-dioxygenase.
25627660 2015 Respiratory syncytial virus induces indoleamine 2,3-dioxygenase activity: a potential novel role in the development of allergic disease.
25584868 2015 CD103 marks a subset of human CD34+-derived langerin+ dendritic cells that induce T-regulatory cells via indoleamine 2,3-dioxygenase-1.
25572287 2015 The tryptophan derivative, tranilast, and conditioned medium with indoleamine 2,3-dioxygenase-expressing cells inhibit the proliferation of lymphoid malignancies.
25541686 2014 IDO1 and IDO2 non-synonymous gene variants: correlation with crohn's disease risk and clinical phenotype.
25461397 2015 Involvement of the TNF-?/TGF-?/IDO axis in IVIg-induced immune tolerance.
25450809 2015 Interferon-? induces a tryptophan-selective amino acid transporter in human colonic epithelial cells and mouse dendritic cells.
25420916 2015 Induction of indoleamine 2,3-dioxygenase by Borrelia burgdorferi in human immune cells correlates with pathogenic potential.
25394548 2014 Heme-binding-mediated negative regulation of the tryptophan metabolic enzyme indoleamine 2,3-dioxygenase 1 (IDO1) by IDO2.
25313323 2014 Crystal Structures and Structure-Activity Relationships of Imidazothiazole Derivatives as IDO1 Inhibitors.
25310899 2015 Human renal tubular epithelial cells suppress alloreactive T cell proliferation.
25308308 2015 Enhanced expression of indoleamine 2,3-dioxygenase in Helicobacter pylori-infected human gastric mucosa modulates Th1/Th2 pathway and interleukin 17 production.
25283845 2015 Transcriptomic profiling of human choriodecidua during term labor: inflammation as a key driver of labor.
25274283 2014 Elevation of MMP-9 and IDO induced by pancreatic cancer cells mediates natural killer cell dysfunction.
25248875 2015 Expression of indoleamine 2,3-dioxygenase in leukemic cells indicates an unfavorable prognosis in acute myeloid leukemia patients with intermediate-risk cytogenetics.
25200149 2014 [Expression of indoleamine 2, 3-dioxygenase modulates macrophage polarization in THP-1 cells].
25157255 2014 New Insights into IDO Biology in Bacterial and Viral Infections.
25113564 2014 Human fibrocytic myeloid-derived suppressor cells express IDO and promote tolerance via Treg-cell expansion.
25081660 2014 Analysis of indoleamine 2-3 dioxygenase (IDO) and EGFR co-expression in breast cancer tissue by immunohistochemistry.
25063873 2014 Noncanonical NF-?B activation mediates STAT3-stimulated IDO upregulation in myeloid-derived suppressor cells in breast cancer.
25060643 2014 Cancer/stroma interplay via cyclooxygenase-2 and indoleamine 2,3-dioxygenase promotes breast cancer progression.
25031694 2014 Indoleamine 2,3-dioxygenase-1 (IDO1) in human endometrial stromal cells induces macrophage tolerance through interleukin-33 in the progression of endometriosis.
24988959 2014 [A study of IL-1? and IDO gene polymorphisms in patients with schizophrenia].
24903009 2014 Indoleamine 2,3-dioxygenase 1 (IDO1) activity in leukemia blasts correlates with poor outcome in childhood acute myeloid leukemia.
24875753 2014 Human indoleamine 2,3-dioxygenase-2 has substrate specificity and inhibition characteristics distinct from those of indoleamine 2,3-dioxygenase-1.
24870595 2014 The subsets of dendritic cells and memory T cells correspond to indoleamine 2,3-dioxygenase in stomach tumor microenvironment.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24795458 2014 S100A4 and uric acid promote mesenchymal stromal cell induction of IL-10+/IDO+ lymphocytes.
24742251 2014 Expression of indoleamine 2,3-dioxygenase and infiltration of FOXP3+ regulatory T cells are associated with aggressive features of papillary thyroid microcarcinoma.
24732701 2014 A paradoxical pattern of indoleamine 2,3-dioxygenase expression in the colon tissues of patients with acute graft-versus-host disease.
24721110 The role of indoleamine 2,3-dioxygenase (IDO) in immune tolerance: focus on macrophage polarization of THP-1 cells.
24717869 Relationships of indoleamine 2,3-dioxygenase activity and cofactors with asthma and nasal polyps.
24696473 2014 Epstein-Barr virus infection induces indoleamine 2,3-dioxygenase expression in human monocyte-derived macrophages through p38/mitogen-activated protein kinase and NF-?B pathways: impairment in T cell functions.
24687552 2014 IDO is highly expressed in breast cancer and breast cancer-derived circulating microvesicles and associated to aggressive types of tumors by in silico analysis.
24612287 2014 Redox control of indoleamine 2,3-dioxygenase expression and activity in human monocyte-derived dendritic cells is independent of changes in oxygen tension.
24517146 2014 Indoleamine 2,3-dioxygenase 1 (IDO1) is up-regulated in thyroid carcinoma and drives the development of an immunosuppressant tumor microenvironment.
24391212 2014 The SOCS3-independent expression of IDO2 supports the homeostatic generation of T regulatory cells by human dendritic cells.
24337170 2014 Checks and balances between human cytomegalovirus replication and indoleamine-2,3-dioxygenase.
24282429 2013 Indoleamine 2,3-dioxygenase: expressing cells in inflammatory bowel disease-a cross-sectional study.
24268989 2014 IDO and CD83 expression in human epidermal Langerhans cells.
24252613 2014 Pro-inflammatory cytokines downregulate Hsp27 and cause apoptosis of human retinal capillary endothelial cells.
24102581 2014 Human amniotic fluid stem cells suppress PBMC proliferation through IDO and IL-10-dependent pathways.
23986400 2013 Up-regulation of PD-L1, IDO, and T(regs) in the melanoma tumor microenvironment is driven by CD8(+) T cells.
23973990 2013 Cyclooxygenase-2 (COX-2) inhibition constrains indoleamine 2,3-dioxygenase 1 (IDO1) activity in acute myeloid leukaemia cells.
23949777 2013 Forced expression of indoleamine-2,3-dioxygenase in human umbilical cord-derived mesenchymal stem cells abolishes their anti-apoptotic effect on leukemia cell lines in vitro.
23940074 2014 The IDO1-induced kynurenines play a major role in the antimicrobial effect of human myeloid cells against Listeria monocytogenes.
23853597 2013 IL-22 and IDO1 affect immunity and tolerance to murine and human vaginal candidiasis.
23847296 2013 Indoleamine 2,3-dioxygenase levels at the normal and recurrent spontaneous abortion fetal-maternal interface.
23752227 2013 Indoleamine 2,3-dioxygenase is a critical resistance mechanism in antitumor T cell immunotherapy targeting CTLA-4.
23751345 2013 Mutation of cysteine residues alters the heme-binding pocket of indoleamine 2,3-dioxygenase-1.
23682557 2014 Up-regulated expression of indoleamine 2,3-dioxygenase 1 in non-Hodgkin lymphoma correlates with increased regulatory T-cell infiltration.
23669411 2013 IDO1 metabolites activate ?-catenin signaling to promote cancer cell proliferation and colon tumorigenesis in mice.
23651343 2013 Serum levels and activity of indoleamine2,3-dioxygenase and tryptophanyl-tRNA synthetase and their association with disease severity in patients with chronic kidney disease.
23620105 2013 Silencing of indoleamine 2,3-dioxygenase enhances dendritic cell immunogenicity and antitumour immunity in cancer patients.
23440412 2013 Myeloid-derived suppressor cells suppress antitumor immune responses through IDO expression and correlate with lymph node metastasis in patients with breast cancer.
23426156 2013 Expression of indoleamine 2,3-dioxygenase and correlation with pathological malignancy in gliomas.
23413147 2013 Indoleamine 2,3-dioxygenase activity as a potential biomarker of immune suppression during visceral leishmaniasis.
23411497 2013 Indoleamine 2,3-dioxygenase-1 (IDO1) enhances survival and invasiveness of endometrial stromal cells via the activation of JNK signaling pathway.
23358471 2013 In vivo metabolism of tryptophan in meningiomas is mediated by indoleamine 2,3-dioxygenase 1.
23344392 2013 Analysis of indoleamine 2-3 dioxygenase (IDO1) expression in breast cancer tissue by immunohistochemistry.
23289444 2013 B7 costimulation and intracellular indoleamine-2,3-dioxygenase expression in peripheral blood of healthy pregnant and pre-eclamptic women.
23232072 2012 Indoleamine 2,3-dioxygenase 1 (IDO1) activity correlates with immune system abnormalities in multiple myeloma.
23209301 2013 Human indoleamine 2,3-dioxygenase is a catalyst of physiological heme peroxidase reactions: implications for the inhibition of dioxygenase activity by hydrogen peroxide.
23200754 2013 Indoleamine 2,3 dioxygenase gene polymorphisms correlate with CD8+ Treg impairment in systemic sclerosis.
23179760 2013 Tumoral indoleamine 2,3-dioxygenase expression predicts poor outcome in laryngeal squamous cell carcinoma.
23109825 2012 Indoleamine 2,3-dioxygenase (IDO) downregulates the cell surface expression of the CD4 molecule.
23103127 2013 Indoleamine 2,3 dioxygenase and metabolic control of immune responses.
23090116 2012 Systemic delivery of Salmonella typhimurium transformed with IDO shRNA enhances intratumoral vector colonization and suppresses tumor growth.
22936460 2013 Decreased expression of indoleamine 2,3-dioxygenase 1 in dendritic cells contributes to impaired regulatory T cell development in immune thrombocytopenia.
22932670 2012 IDO expression in brain tumors increases the recruitment of regulatory T cells and negatively impacts survival.
22929065 2012 Indoleamine 2,3-dioxygenase activation and depressive symptoms: results from the Young Finns Study.
22923135 2012 Downregulation of indoleamine-2,3-dioxygenase in cervical cancer cells suppresses tumor growth by promoting natural killer cell accumulation.
22913669 2013 Mesoangioblasts suppress T cell proliferation through IDO and PGE-2-dependent pathways.
22891315 2012 Indole peroxygenase activity of indoleamine 2,3-dioxygenase.
22860140 2012 Activation of indoleamine 2,3-dioxygenase in patients with scrub typhus and its role in growth restriction of Orientia tsutsugamushi.
22828446 2013 Immunosuppressive CD14+HLA-DRlow/neg IDO+ myeloid cells in patients following allogeneic hematopoietic stem cell transplantation.
22751107 2012 Brain indoleamine 2,3-dioxygenase contributes to the comorbidity of pain and depression.
22722711 2012 Induction of indoleamine-2,3 dioxygenase in bone marrow stromal cells inhibits myeloma cell growth.
22690871 2012 The cystine/glutamate antiporter regulates the functional expression of indoleamine 2,3-dioxygenase in human dendritic cells.
22638210 2012 Inhibition of IDO1 suppresses cyclooxygenase-2 and matrix metalloproteinase-9 expression and decreases proliferation, adhesion and invasion of endometrial stromal cells.
22592557 2012 Tryptophan metabolism activation by indoleamine 2,3-dioxygenase in adipose tissue of obese women: an attempt to maintain immune homeostasis and vascular tone.
22526360 2012 Decreased indoleamine 2,3-dioxygenase expression in dendritic cells and role of indoleamine 2,3-dioxygenase-expressing dendritic cells in immune thrombocytopenia.
22519828 2012 Indoleamine 2,3-dioxygenase expression and functional activity in dendritic cells exposed to cholera toxin.
22424783 2012 An epigenetic mechanism for high, synergistic expression of indoleamine 2,3-dioxygenase 1 (IDO1) by combined treatment with zebularine and IFN-?: potential therapeutic use in autoimmune diseases.
22301793 2012 Flavivirus infection induces indoleamine 2,3-dioxygenase in human monocyte-derived macrophages via tumor necrosis factor and NF-?B.
22202241 2011 [Study of indoleamine 2,3-dioxygenase expression in patients of thyroid cancer].
22184722 2012 Activated CD69+ T cells foster immune privilege by regulating IDO expression in tumor-associated macrophages.
22112045 2012 Indoleamine 2,3-dioxygenase expression and serum kynurenine concentrations in patients with diffuse large B-cell lymphoma.
22110525 2011 Upregulated expression of indoleamine 2, 3-dioxygenase in primary breast cancer correlates with increase of infiltrated regulatory T cells in situ and lymph node metastasis.
22093628 2011 [Expression of indoleamine 2, 3-dioxygenase and its correlation with prognosis in breast cancer patients].
22069308 2012 A novel role for interleukin-27 (IL-27) as mediator of intestinal epithelial barrier protection mediated via differential signal transducer and activator of transcription (STAT) protein signaling and induction of antibacterial and anti-inflammatory proteins.
22039265 2011 Tryptophan catabolism is associated with acute GVHD after human allogeneic stem cell transplantation and indicates activation of indoleamine 2,3-dioxygenase.
22013481 2011 Involvement of indoleamine 2,3-dioxygenase in impairing tumor-infiltrating CD8 T-cell functions in esophageal squamous cell carcinoma.
21980470 2011 Identification of a variable number of tandem repeats polymorphism and characterization of LEF-1 response elements in the promoter of the IDO1 gene.
21952237 2011 Toll-like receptor-3 ligation-induced indoleamine 2, 3-dioxygenase expression in human trophoblasts.
21892828 2011 The mechanism of formation of N-formylkynurenine by heme dioxygenases.
21835273 2011 Purification and kinetic characterization of human indoleamine 2,3-dioxygenases 1 and 2 (IDO1 and IDO2) and discovery of selective IDO1 inhibitors.
21835147 2012 IDO in human gut graft-versus-host disease.
21823214 2012 Serum analysis of tryptophan catabolism pathway: correlation with Crohn's disease activity.
21755000 2011 Vascular endothelial expression of indoleamine 2,3-dioxygenase 1 forms a positive gradient towards the feto-maternal interface.
21742973 2011 IDO induces expression of a novel tryptophan transporter in mouse and human tumor cells.
21712776 2011 Somatization, but not depression, is characterized by disorders in the tryptophan catabolite (TRYCAT) pathway, indicating increased indoleamine 2,3-dioxygenase and lowered kynurenine aminotransferase activity.
21693183 2011 Lack of association of indoleamine 2,3-dioxygenase polymorphisms with interferon-alpha-related depression in hepatitis C.
21692032 2011 Myeloid CD11c+ S100+ dendritic cells express indoleamine 2,3-dioxygenase at the inflammatory border to invasive lower lip squamous cell carcinoma.
21691274 2012 Association of a polymorphism in the indoleamine- 2,3-dioxygenase gene and interferon-?-induced depression in patients with chronic hepatitis C.
21690092 2011 NADH oxidase activity of indoleamine 2,3-dioxygenase.
21666788 2011 Effects of chronic ascariasis and trichuriasis on cytokine production and gene expression in human blood: a cross-sectional study.
21617756 2011 Is the variant c.422+90G ? A in intron 4 of indoleamine 2, 3 -dioxygenase (IDO) gene related to age related cataracts?
21616522 2011 Expression of indoleamine 2,3-dioxygenase predicts shorter survival in patients with vulvar squamous cell carcinoma (vSCC) not influencing on the recruitment of FOXP3-expressing regulatory T cells in cancer nests.
21600662 2011 Moderating effect of indoleamine 2,3-dioxygenase (IDO) activation in the association between depressive symptoms and carotid atherosclerosis: evidence from the Young Finns study.
21592112 2011 The role of indoleamine 2, 3-dioxygenase in lepromatous leprosy immunosuppression.
21575365 2011 [An experimental study on the regulation of bone marrow-derived mesenchymal stem cells through indoleamine 2,3-dioxygenase signaling pathway by thymosin ?1 for improving the immunosuppression mediated by T cell].
21517757 2011 Regulation of expression and function of IDO in human dendritic cells.
21517756 2011 Induction of regulatory T Cells by dendritic cells through indoleamine 2,3-dioxygenase: a potent mechanism of acquired peripheral tolerance.
21517755 2011 Indoleamine 2,3-dioxygenase, Tregs and cancer.
21517753 2011 Indoleamine 2,3-dioxygenase as a modifier of pathogenic inflammation in cancer and other inflammation-associated diseases.
21517752 2011 The interplay between indoleamine 2,3-dioxygenase 1 (IDO1) and cyclooxygenase (COX)-2 in chronic inflammation and cancer.
21502325 2011 Ferryl derivatives of human indoleamine 2,3-dioxygenase.
21501890 2011 Indoleamine 2,3-dioxygenase-expressing myeloid dendritic cells and macrophages in infectious and noninfectious cutaneous granulomas.
21487895 2011 Decreased IDO activity and increased TTS expression break immune tolerance in patients with immune thrombocytopenia.
21461581 Immunoactivative role of indoleamine 2,3?dioxygenase in gastric cancer cells in vitro.
21461563 Reduced expression of indoleamine 2,3-dioxygenase participates in pathogenesis of preeclampsia via regulatory T cells.
21361337 2011 Structure and reaction mechanism in the heme dioxygenases.
21359206 2011 Interferon-? regulates the proliferation and differentiation of mesenchymal stem cells via activation of indoleamine 2,3 dioxygenase (IDO).
21355883 Potential immunosuppressive function of plasma indoleamine 2,3-dioxygenase in patients with aGVHD after allo-HSCT.
21328335 2012 High expression of indoleamine 2,3-dioxygenase in the tumour is associated with medullary features and favourable outcome in basal-like breast carcinoma.
21324164 2011 The relationship between indoleamine 2,3-dioxygenase activity and post-stroke cognitive impairment.
21292009 2011 Indoleamine 2,3-dioxygenase is increased in hemodialysis patients and affects immune response to hepatitis B vaccination.
21176371 2010 [Regulatory effect of thymosin ?1 on expression of tlr9/ido mRNA in bone marrow mesenchymal stem cells from children with aplastic anemia].
21118329 2011 Multiple sclerosis, seizures, and antiepileptics: role of IL-18, IDO, and melatonin.
21094802 2010 High levels of IDO-expressing CD16+ peripheral cells, and Tregs in graft biopsies from kidney transplant recipients under belatacept treatment.
21030093 2011 Coding region polymorphisms in the indoleamine 2,3-dioxygenase (INDO) gene and recurrent spontaneous abortion.
21028817 2010 A specific interaction of L-tryptophan with CO of CO-bound indoleamine 2,3-dioxygenase identified by resonance Raman spectroscopy.
20938662 2011 Indoleamine 2,3-dioxygenase in tumor tissue indicates prognosis in patients with diffuse large B-cell lymphoma treated with R-CHOP.
20801903 2010 Indoleamine 2,3-dioxygenase-expressing leukemic dendritic cells impair a leukemia-specific immune response by inducing potent T regulatory cells.
20689575 2010 Psychological stress-induced, IDO1-dependent tryptophan catabolism: implications on immunosuppression in mice and humans.
20663292 2010 Indoleamine 2,3-dioxygenase and 3-hydroxykynurenine modifications are found in the neuropathology of Alzheimer's disease.
20648630 2010 High expression of IMPACT protein promotes resistance to indoleamine 2,3-dioxygenase-induced cell death.
20635895 2010 Beyond immunosuppression: reconsidering indoleamine 2,3-dioxygenase as a pathogenic element of chronic inflammation.
20570568 2010 Intact indoleamine 2,3-dioxygenase activity in human chronic granulomatous disease.
20522587 2010 Local expression of indoleamine 2,3 dioxygenase in syngeneic fibroblasts significantly prolongs survival of an engineered three-dimensional islet allograft.
20484731 2010 Tryptophan catabolism by indoleamine 2,3-dioxygenase 1 alters the balance of TH17 to regulatory T cells in HIV disease.
20386557 Immunosuppressive properties of human umbilical cord-derived mesenchymal stem cells: role of B7-H1 and IDO.
20361220 2010 The first step of the dioxygenation reaction carried out by tryptophan dioxygenase and indoleamine 2,3-dioxygenase as revealed by quantum mechanical/molecular mechanical studies.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
20192952 2010 Genetic variation in the indoleamine 2,3-dioxygenase gene in pre-eclampsia.
20128646 2010 The role of indoleamine 2,3-dioxygenase in retinal pigment epithelial cell-mediated immune modulation.
19933867 2009 Human activated T lymphocytes modulate IDO expression in tumors through Th1/Th2 balance.
19929471 2009 Indoleamine-2,3-dioxygenase enzyme expression and activity in polarized dendritic cells.
19844741 2009 Localization of indoleamine 2,3-dioxygenase in human esophageal squamous cell carcinomas.
19829303 2010 Indoleamine 2,3-dioxygenase+ cells correspond to the BDCA2+ plasmacytoid dendritic cells in human melanoma sentinel nodes.
19828629 2009 Amino acid deprivation links BLIMP-1 to the immunomodulatory enzyme indoleamine 2,3-dioxygenase.
19815714 2009 Thymic indoleamine 2,3-dioxygenase-positive eosinophils in young children: potential role in maturation of the naive immune system.
19783182 2009 Indoleamine 2,3-dioxygenase in lung allograft tolerance.
19740345 2009 Modulation of dendritic cell maturation and function with mono- and bifunctional small interfering RNAs targeting indoleamine 2,3-dioxygenase.
19737010 2009 Inhibitory substrate binding site of human indoleamine 2,3-dioxygenase.
19695096 2009 The paradoxical patterns of expression of indoleamine 2,3-dioxygenase in colon cancer.
19693771 2009 Hemoglobin induces the expression of indoleamine 2,3-dioxygenase in dendritic cells through the activation of PI3K, PKC, and NF-kappaB and the generation of reactive oxygen species.
19604349 2009 Simultaneous Foxp3 and IDO expression is associated with sentinel lymph node metastases in breast cancer.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19597340 2009 IDO inhibits T-cell function through suppressing Vav1 expression and activation.
19564344 2009 Reduced cytotoxic function of effector CD8+ T cells is responsible for indoleamine 2,3-dioxygenase-dependent immune suppression.
19514129 2009 Identification of genetic variants in the human indoleamine 2,3-dioxygenase (IDO1) gene, which have altered enzyme activity.
19489917 2009 Gene-expression profiles in human nasal polyp tissues and identification of genetic susceptibility in aspirin-intolerant asthma.
19487045 2010 Increased serum kynurenine/tryptophan ratio correlates with disease progression in lung cancer.
19465693 2009 Indoleamine 2,3-dioxygenase-expressing mature human monocyte-derived dendritic cells expand potent autologous regulatory T cells.
19448397 2009 Expression of indoleamine 2,3-dioxygenase in metastatic malignant melanoma recruits regulatory T cells to avoid immune detection and affects survival.
19434461 Imaging correlates of differential expression of indoleamine 2,3-dioxygenase in human brain tumors.
19363598 2009 Increased TTS abrogates IDO-mediated CD4(+) T cells suppression in patients with Graves' disease.
19353519 2009 Toll-like receptor engagement enhances the immunosuppressive properties of human bone marrow-derived mesenchymal stem cells by inducing indoleamine-2,3-dioxygenase-1 via interferon-beta and protein kinase R.
19306922 2009 Free iron ions decrease indoleamine 2,3-dioxygenase expression and reduce IFNgamma-induced inhibition of Chlamydia trachomatis infection.
19264674 2009 Increased activity of indoleamine 2,3-dioxygenase in serum from acutely infected dengue patients linked to gamma interferon antiviral function.
19168733 2009 Intralesional regulatory T-cell suppressive function during human acute and chronic cutaneous leishmaniasis due to Leishmania guyanensis.
19155537 2009 Increased indoleamine 2,3-dioxygenase (IDO) activity and elevated serum levels of tryptophan catabolites in patients with chronic kidney disease: a possible link between chronic inflammation and uraemic symptoms.
19106591 2008 [Indoleamine 2,3-dioxygenase expression in breast cancer patients during chemotherapy].
19074858 2008 Critical role of indoleamine 2,3-dioxygenase in tumor resistance to repeated treatments with targeted IFNgamma.
19058839 2009 Der p 1 suppresses indoleamine 2, 3-dioxygenase in dendritic cells from house dust mite-sensitive patients with asthma.
19050070 2008 High INDO (indoleamine 2,3-dioxygenase) mRNA level in blasts of acute myeloid leukemic patients predicts poor clinical outcome.
19010841 2008 Overexpression of indoleamine 2,3-dioxygenase in human endometrial carcinoma cells induces rapid tumor growth in a mouse xenograft model.
19004406 2008 Indoleamine 2,3-dioxygenase expression in gestational trophoblastic disease: implications for development of immunotherapeutic approaches.
18832696 2008 The indoleamine 2,3-dioxygenase pathway is essential for human plasmacytoid dendritic cell-induced adaptive T regulatory cell generation.
18802343 2008 Immune regulation and tolerance to fungi in the lungs and skin.
18776940 2008 HIV-activated human plasmacytoid DCs induce Tregs through an indoleamine 2,3-dioxygenase-dependent mechanism.
18660700 2008 Clinical relevance of indoleamine 2,3-dioxygenase for alloimmunity and transplantation.
18639339 2009 Indoleamine 2,3-dioxygenase activity of acute myeloid leukemia cells can be measured from patients' sera by HPLC and is inducible by IFN-gamma.
18622801 2008 Indoleamine 2,3-dioxygenase activity associates with cardiovascular risk factors: the Health 2000 study.
18438685 2008 Expression and prognosis role of indoleamine 2,3-dioxygenase in hepatocellular carcinoma.
18418598 2009 IDO1 and IDO2 are expressed in human tumors: levo- but not dextro-1-methyl tryptophan inhibits tryptophan catabolism.
18370410 2008 The role of serine 167 in human indoleamine 2,3-dioxygenase: a comparison with tryptophan 2,3-dioxygenase.
18332894 2008 Suppression of cytotoxic and proliferative xenogeneic T-cell responses by transgenic expression of indoleamine 2,3-dioxygenase.
18299324 2008 Cytochrome b5, not superoxide anion radical, is a major reductant of indoleamine 2,3-dioxygenase in human cells.
18274832 2009 Mouse and human indoleamine 2,3-dioxygenase display some distinct biochemical and structural properties.
18205804 2008 Antimicrobial and immunoregulatory effects mediated by human lung cells: role of IFN-gamma-induced tryptophan degradation.
18176870 2008 Impaired indoleamine 2,3-dioxygenase production contributes to the development of autoimmunity in primary biliary cirrhosis.
18055547 2007 Indoleamine 2,3-dioxygenase (IDO): the antagonist of type I interferon-driven skin inflammation?
18045970 2008 Levo- but not dextro-1-methyl tryptophan abrogates the IDO activity of human dendritic cells.
18036645 2008 Sputum indoleamine-2, 3-dioxygenase activity is increased in asthmatic airways by using inhaled corticosteroids.
18026683 2007 Evolution of vertebrate indoleamine 2,3-dioxygenases.
18008147 2008 Differential immunosuppressive effect of indoleamine 2,3-dioxygenase (IDO) on primary human CD4+ and CD8+ T cells.
17951526 2008 Mesenchymal stem cells inhibit natural killer-cell proliferation, cytotoxicity, and cytokine production: role of indoleamine 2,3-dioxygenase and prostaglandin E2.
17911610 2007 Induction of indoleamine 2,3-dioxygenase in vascular smooth muscle cells by interferon-gamma contributes to medial immunoprivilege.
17711549 2007 Nonviral gene delivery with indoleamine 2,3-dioxygenase targeting pulmonary endothelium protects against ischemia-reperfusion injury.
17674321 2007 Intralesional expression of mRNA of interferon- gamma , tumor necrosis factor- alpha , interleukin-10, nitric oxide synthase, indoleamine-2,3-dioxygenase, and RANTES is a major immune effector in Mediterranean spotted fever rickettsiosis.
17671174 2007 Novel tryptophan catabolic enzyme IDO2 is the preferred biochemical target of the antitumor indoleamine 2,3-dioxygenase inhibitory compound D-1-methyl-tryptophan.
17626075 2007 Astrocyte indoleamine 2,3-dioxygenase is induced by the TLR3 ligand poly(I:C): mechanism of induction and role in antiviral response.
17605849 2007 Indoleamine 2, 3-dioxygenase expression in cells of human acute monocyte leukemia (M(5)) and acute lymphocyte leukemia and therapeutic effect of its inhibitor 1-methyl tryptophan.
17535808 2007 Post-translational regulation of human indoleamine 2,3-dioxygenase activity by nitric oxide.
17433037 2007 Expression of indoleamine 2, 3-dioxygenase and the recruitment of Foxp3-expressing regulatory T cells in the development and progression of uterine cervical cancer.
17393386 2007 On watching the watchers: IDO and type I/II IFN.
17321596 2007 Indoleamine-dioxygenase is expressed in human decidua at the time maternal tolerance is established.
17318080 2007 Are indoleamine-2,3-dioxygenase producing human dendritic cells a tool for suppression of allogeneic T-cell responses?
17294609 2007 A putative mechanism on remission of multiple sclerosis during pregnancy: estrogen-induced indoleamine 2,3-dioxygenase by dendritic cells.
17229698 2007 Upregulation of indoleamine 2,3-dioxygenase in hepatitis C virus infection.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17202379 2007 IL-8 and IDO expression by human gingival fibroblasts via TLRs.
17192467 2007 Induction of indoleamine 2,3-dioxygenase by interferon-gamma in human islets.
17182891 2007 Upregulation of placental indoleamine 2,3-dioxygenase by human chorionic gonadotropin.
17170728 2007 Acute myeloid leukemia cells constitutively express the immunoregulatory enzyme indoleamine 2,3-dioxygenase.
17038913 2006 Rabbit antithymocyte globulin inhibits monocyte-derived dendritic cells maturation in vitro and polarizes monocyte-derived dendritic cells towards tolerogenic dendritic cells expressing indoleamine 2,3-dioxygenase.
17015408 2006 Sleeping Beauty-based gene therapy with indoleamine 2,3-dioxygenase inhibits lung allograft fibrosis.
16842443 2006 Low serum tryptophan levels, reduced macrophage IDO activity and high frequency of psychopathology in HCV patients.
16834326 2006 Interactions between nitric oxide and indoleamine 2,3-dioxygenase.
16686756 2006 Expression of indoleamine 2,3-dioxygenase (IDO) by endothelial cells: implications for the control of alloresponses.
16574111 2006 Cytochrome b(5) is a major reductant in vivo of human indoleamine 2,3-dioxygenase expressed in yeast.
16513157 2006 Indoleamine 2,3-dioxygenase activity in nonagenarians is markedly increased and predicts mortality.
16511306 2006 Crystallization and preliminary crystallographic studies of human indoleamine 2,3-dioxygenase.
16489067 2006 Prognostic value of indoleamine 2,3-dioxygenase expression in colorectal cancer: effect on tumor-infiltrating T cells.
16477023 2006 Crystal structure of human indoleamine 2,3-dioxygenase: catalytic mechanism of O2 incorporation by a heme-containing dioxygenase.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16421220 2005 IDO expression on decidual and peripheral blood dendritic cells and monocytes/macrophages after treatment with CTLA-4 or interferon-gamma increase in normal pregnancy but decrease in spontaneous abortion.
16406698 2006 The immunoregulatory role of IDO-producing human dendritic cells revisited.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16319139 2005 Heme oxygenase-1 inhibits rat and human breast cancer cell proliferation: mutual cross inhibition with indoleamine 2,3-dioxygenase.
16176799 2005 Biochemical and medical aspects of the indoleamine 2,3-dioxygenase-initiated L-tryptophan metabolism.
16135011 2005 Reduced uterine indoleamine 2,3-dioxygenase versus increased Th1/Th2 cytokine ratios as a basis for occult and clinical pregnancy failure in mice and humans.
15967116 2005 Eosinophil granulocytes account for indoleamine 2,3-dioxygenase-mediated immune escape in human non-small cell lung cancer.
15950064 2005 Localisation of indoleamine 2,3-dioxygenase and kynurenine hydroxylase in the human placenta and decidua: implications for role of the kynurenine pathway in pregnancy.
15947091 2005 A two-step induction of indoleamine 2,3 dioxygenase (IDO) activity during dendritic-cell maturation.
15919929 2005 Indoleamine 2,3-dioxygenase mediates cell type-specific anti-measles virus activity of gamma interferon.
15711557 2005 Inhibition of indoleamine 2,3-dioxygenase, an immunoregulatory target of the cancer suppression gene Bin1, potentiates cancer chemotherapy.
15528322 2004 Cutting edge: human eosinophils regulate T cell subset selection through indoleamine 2,3-dioxygenase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15374002 2004 Inhibition of human herpes simplex virus type 2 by interferon gamma and tumor necrosis factor alpha is mediated by indoleamine 2,3-dioxygenase.
15254595 2004 Expression of indoleamine 2,3-dioxygenase by plasmacytoid dendritic cells in tumor-draining lymph nodes.
15245429 2004 Human epidermal langerhans cells express the immunoregulatory enzyme indoleamine 2,3-dioxygenase.
15102781 2004 Nitric oxide-mediated regulation of gamma interferon-induced bacteriostasis: inhibition and degradation of human indoleamine 2,3-dioxygenase.
15070879 2004 Mechanisms regulating the expression of indoleamine 2,3-dioxygenase during decidualization of human endometrium.
15001472 2004 Human bone marrow stromal cells inhibit allogeneic T-cell responses by indoleamine 2,3-dioxygenase-mediated tryptophan degradation.
14969766 2004 Cell surface expression of MHC class I antigen is suppressed in indoleamine 2,3-dioxygenase genetically modified keratinocytes: implications in allogeneic skin substitute engraftment.
14871294 2004 Indoleamine 2,3-dioxygenase is necessary for cytolytic activity of natural killer cells.
14704851 2004 Enzymology of NAD+ homeostasis in man.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14502282 2003 Evidence for a tumoral immune resistance mechanism based on tryptophan degradation by indoleamine 2,3-dioxygenase.
13678429 2003 Synergistic transcriptional activation of indoleamine dioxygenase by IFN-gamma and tumor necrosis factor-alpha.
12963490 2003 Inhibition of indoleamine 2,3-dioxygenase activity in IFN-gamma stimulated astroglioma cells decreases intracellular NAD levels.
12938169 2003 Immune cell proliferation is suppressed by the interferon-gamma-induced indoleamine 2,3-dioxygenase expression of fibroblasts populated in collagen gel (FPCG).
12766158 2003 Asp274 and his346 are essential for heme binding and catalytic function of human indoleamine 2,3-dioxygenase.
12738417 2003 Tolerance, DCs and tryptophan: much ado about IDO.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471139 2002 IFN-gamma amplifies IL-6 and IL-8 responses by airway epithelial-like cells via indoleamine 2,3-dioxygenase.
12444143 2002 HIV-1 protein Vpr suppresses IL-12 production from human monocytes by enhancing glucocorticoid action: potential implications of Vpr coactivator activity for the innate and cellular immunity deficits observed in HIV-1 infection.
12228717 2002 Potential regulatory function of human dendritic cells expressing indoleamine 2,3-dioxygenase.
12186837 2002 Inhibition of allogeneic T cell proliferation by indoleamine 2,3-dioxygenase-expressing dendritic cells: mediation of suppression by tryptophan metabolites.
11987129 2002 Proteomic analysis of cytokine induced proteins in human intestinal epithelial cells: implications for inflammatory bowel diseases.
11912287 2002 Localization of indoleamine 2,3-dioxygenase in human female reproductive organs and the placenta.
11876748 2002 Placentally derived prostaglandin E2 acts via the EP4 receptor to inhibit IL-2-dependent proliferation of CTLL-2 T cells.
11867636 2002 The heme environment of recombinant human indoleamine 2,3-dioxygenase. Structural properties and substrate-ligand interactions.
11230514 2001 The role of L-tryptophan transport in L-tryptophan degradation by indoleamine 2,3-dioxygenase in human placental explants.
11180976 2001 Indoleamine 2,3-dioxygenase in the human lens, the first enzyme in the synthesis of UV filters.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9712583 1998 Prevention of allogeneic fetal rejection by tryptophan catabolism.
8817290 1996 Indoleamine 2,3-dioxygenase: antioxidant enzyme in the human eye.
8406467 1993 Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8.
8404046 1993 Localization of indoleamine 2,3-dioxygenase gene (INDO) to chromosome 8p12-->p11 by fluorescent in situ hybridization.
2848333 1988 Pulmonary indoleamine 2,3-dioxygenase activity and its significance in the response of rats, mice, and rabbits to oxidative stress.
2549057 1989 Effects of tryptophan and pH on the kinetics of superoxide radical binding to indoleamine 2,3-dioxygenase studied by pulse radiolysis.
2501398 1989 Interferon-induced indoleamine 2,3-dioxygenase activity inhibits Chlamydia psittaci replication in human macrophages.
2482041 1989 Tumour necrosis factor-alpha and lipopolysaccharide enhance interferon-induced tryptophan degradation and pteridine synthesis in human cells.
2326172 1990 Primary structure of human indoleamine 2,3-dioxygenase deduced from the nucleotide sequence of its cDNA.
2109605 1990 Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA.
1907934 1991 Relationship between interferon-gamma, indoleamine 2,3-dioxygenase, and tryptophan catabolism.
1716396 1991 Localization and developmental change of indoleamine 2,3-dioxygenase activity in the human placenta.
1449503 1992 Gene structure of human indoleamine 2,3-dioxygenase.