Property Summary

NCBI Gene PubMed Count 17
PubMed Score 37.33
PubTator Score 11.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
glioblastoma -1.500 6.2e-04
astrocytoma -1.600 9.1e-03
medulloblastoma, large-cell -1.100 1.1e-03
pancreatic ductal adenocarcinoma liver m... -1.767 7.1e-03
intraductal papillary-mucinous adenoma (... 1.300 1.4e-02
intraductal papillary-mucinous carcinoma... 1.400 2.1e-02
lung cancer -1.500 5.1e-05
active Crohn's disease 1.207 5.4e-03
group 4 medulloblastoma -1.200 2.9e-04
lung adenocarcinoma -1.100 1.0e-07
spina bifida -1.940 3.6e-02
Pick disease -1.300 9.2e-05
progressive supranuclear palsy -1.200 1.2e-02
ovarian cancer 1.900 1.2e-05
Breast cancer 1.100 3.9e-04
chronic rhinosinusitis -1.107 1.0e-02

Protein-protein Interaction (1)

Gene RIF (5)

PMID Text
25950736 The present findings suggest that IDI1 and IDI2 may be associated with the production of cholesterol metabolites in neurons, leading to alpha-synuclein aggregation during the process of Lewy body formation.
20955688 Within the 40-kb region on 10p15.3 subtelomere, which harbours two genes encoding isopentenyl diphosphate isomerase 1 (IDI1) and IDI2, there was found a segmental copy-number gain in a large proportion of sporadic amyotrophic lateral sclerosis patients.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
14629038 only one of the two isoforms (IDI1) is highly conserved, ubiquitously expressed and most likely responsible for housekeeping isomerase activity

AA Sequence

MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFNTENKLLLQQR      1 - 70
SDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKAQS     71 - 140
DGIWGEHEIDYILLVRKNVTLNPDPNEIKSYCYVSKEELKELLKKAASGEIKITPWFKIIAATFLFKWWD    141 - 210
NLNHLNQFVDHEKIYRM                                                         211 - 227
//

Text Mined References (22)

PMID Year Title
25950736 2015 Isopentenyl diphosphate isomerase, a cholesterol synthesizing enzyme, is localized in Lewy bodies.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20955688 2010 Segmental copy-number gain within the region of isopentenyl diphosphate isomerase genes in sporadic amyotrophic lateral sclerosis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
17250851 2007 The crystal structure of human isopentenyl diphosphate isomerase at 1.7 A resolution reveals its catalytic mechanism in isoprenoid biosynthesis.
17202134 2007 IDI2, a second isopentenyl diphosphate isomerase in mammals.
17180682 2007 Localization of the pre-squalene segment of the isoprenoid biosynthetic pathway in mammalian peroxisomes.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14629038 2003 Isopentenyl-diphosphate isomerases in human and mouse: evolutionary analysis of a mammalian gene duplication.
12860252 2003 Copper induces the expression of cholesterogenic genes in human macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8806705 1996 Human isopentenyl diphosphate: dimethylallyl diphosphate isomerase: overproduction, purification, and characterization.
8188698 1994 Farnesyl-diphosphate synthase is localized in peroxisomes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8020941 1994 A human promyelocyte mRNA transiently induced by TPA is homologous to yeast IPP isomerase.