Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.67
PubTator Score 2.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 6.4e-05
non primary Sjogren syndrome sicca 840 4.1e-02
Disease Target Count Z-score Confidence
Zellweger Syndrome 38 3.064 1.5
Inguinal hernia 13 3.06 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 4.1e-02
ovarian cancer 1.400 6.4e-05

Gene RIF (4)

PMID Text
25496667 Genome-wide shRNA screening identifies IDH3G, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of IDH3G by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
17432878 Aspartate-190 is a determinant of IDH gamma subunit affinity for the manganese (MnII) ion, as well as for nicotinamide-adenine dinucleotide (NAD), but is not directly required for the catalytic reaction.
16737955 active sites of the human NAD-IDH are shared between alpha and gamma subunits and between alpha and beta subunits

AA Sequence

MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMIPGDGIGPELM      1 - 70
LHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLD     71 - 140
LYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQE    141 - 210
SGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIV    211 - 280
NNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRK    281 - 350
AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA                               351 - 393
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17432878 2007 Role of alpha-Asp181, beta-Asp192, and gamma-Asp190 in the distinctive subunits of human NAD-specific isocitrate dehydrogenase.
16737955 2006 Identification of Mn2+-binding aspartates from alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
16381901 2006 The LIFEdb database in 2006.
15772651 2005 The DNA sequence of the human X chromosome.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14555658 2003 Evaluation by mutagenesis of the importance of 3 arginines in alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11181995 2001 The sequence of the human genome.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10677231 2000 Bovine NAD+-dependent isocitrate dehydrogenase: alternative splicing and tissue-dependent expression of subunit 1.
10601238 1999 Identification and functional characterization of a novel, tissue-specific NAD(+)-dependent isocitrate dehydrogenase beta subunit isoform.
9286695 1997 Genomic organization of two novel genes on human Xq28: compact head to head arrangement of IDH gamma and TRAP delta is conserved in rat and mouse.
8661155 1996 The genomic organization of a human creatine transporter (CRTR) gene located in Xq28.