Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.44
PubTator Score 6.36

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.456 9.8e-03
astrocytic glioma -1.400 1.6e-02
psoriasis 1.600 3.7e-09
posterior fossa group A ependymoma -1.300 1.3e-10
glioblastoma -1.500 8.0e-06
sonic hedgehog group medulloblastoma -2.000 8.5e-09
atypical teratoid / rhabdoid tumor -2.200 2.8e-09
medulloblastoma, large-cell -1.700 2.9e-06
primitive neuroectodermal tumor -1.500 1.1e-05
Atopic dermatitis 1.100 9.2e-05
colon cancer -1.100 8.8e-03
adult high grade glioma -1.500 5.7e-06
ovarian cancer 1.700 6.8e-04
pituitary cancer 1.100 2.6e-07

 MGI Phenotype (1)

Gene RIF (8)

PMID Text
25531325 The silencing of IDH3a significantly delayed tumor growth by suppressing the HIF-1-mediated Warburg effect and angiogenesis.
23125841 Tandem affinity purification and mass spectrometry analysis identify isocitrate dehydrogenase 3 (NAD+) alpha subunit (IDH3A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22190034 Tandem affinity purification and mass spectrometry analysis identify isocitrate dehydrogenase 3 (NAD+) alpha subunit (IDH3A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
20877624 Observational study of gene-disease association. (HuGE Navigator)
20306291 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17432878 Asp181 is essential for nicotinamide-adenine dinucleotide (NAD)-specific IDH alpha subunit catalysis and may also facilitate the binding of substrates.
16737955 active sites of the human NAD-IDH are shared between alpha and gamma subunits and between alpha and beta subunits
14555658 for IDH, a normal alpha subunit is required for catalytic activity and alpha-Arg88 likely participates in the isocitrate site, whereas the beta and gamma subunits have roles in the nucleotide functions of this allosteric enzyme

AA Sequence

MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAPIQWEERNVTA      1 - 70
IQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDLYANVRPCVSIEGYKTPYTDV     71 - 140
NIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIAEFAFEYARNNHRSNVTAVHKANIMRMSDGL    141 - 210
FLQKCREVAESCKDIKFNEMYLDTVCLNMVQDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGA    211 - 280
NGVAIFESVHGTAPDIAGKDMANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAK    281 - 350
CSDFTEEICRRVKDLD                                                          351 - 366
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25531325 2015 Aberrant IDH3? expression promotes malignant tumor growth by inducing HIF-1-mediated metabolic reprogramming and angiogenesis.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20306291 2010 A three-stage genome-wide association study of general cognitive ability: hunting the small effects.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17432878 2007 Role of alpha-Asp181, beta-Asp192, and gamma-Asp190 in the distinctive subunits of human NAD-specific isocitrate dehydrogenase.
16737955 2006 Identification of Mn2+-binding aspartates from alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14555658 2003 Evaluation by mutagenesis of the importance of 3 arginines in alpha, beta, and gamma subunits of human NAD-dependent isocitrate dehydrogenase.
12543931 2002 Toward a human blood serum proteome: analysis by multidimensional separation coupled with mass spectrometry.
12488461 2002 The human plasma proteome: history, character, and diagnostic prospects.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10677231 2000 Bovine NAD+-dependent isocitrate dehydrogenase: alternative splicing and tissue-dependent expression of subunit 1.
10601238 1999 Identification and functional characterization of a novel, tissue-specific NAD(+)-dependent isocitrate dehydrogenase beta subunit isoform.
8833160 1996 Assignment of the human mitochondrial NAD+ -specific isocitrate dehydrogenase alpha subunit (IDH3A) gene to 15q25.1-->q25.2by in situ hybridization.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7755589 1995 Characterization of a cDNA clone for human NAD(+)-specific isocitrate dehydrogenase alpha-subunit and structural comparison with its isoenzymes from different species.