Property Summary

NCBI Gene PubMed Count 237
PubMed Score 700.87
PubTator Score 288.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
2-hydroxyglutaric aciduria 5 0.0 5.0
Myelofibrosis 13 0.0 5.0
Disease Target Count
Glioma 66

Expression

  Differential Expression (19)

Disease log2 FC p
Multiple myeloma 1.372 5.9e-03
psoriasis 2.100 1.1e-04
osteosarcoma -1.510 8.1e-05
atypical teratoid / rhabdoid tumor -1.200 1.8e-03
medulloblastoma, large-cell -1.100 1.5e-03
tuberculosis 1.200 7.5e-07
pancreatic ductal adenocarcinoma liver m... -2.670 1.3e-03
non-small cell lung cancer 1.312 2.0e-19
intraductal papillary-mucinous adenoma (... -2.100 2.2e-05
intraductal papillary-mucinous neoplasm ... -1.500 4.1e-03
lung cancer 1.900 4.6e-05
posterior fossa group A ependymoma 1.100 1.1e-06
lung adenocarcinoma 1.199 6.7e-07
breast carcinoma 1.100 2.3e-14
Breast cancer 1.100 2.4e-05
gastric carcinoma -1.300 1.2e-02
ductal carcinoma in situ 1.400 5.8e-04
invasive ductal carcinoma 1.700 5.2e-04
ovarian cancer 2.200 2.7e-04

Protein-protein Interaction (3)

Gene RIF (238)

PMID Text
26945349 The IDH2 mutations are associated with improved survival in patients with Glioblastomas.
26834160 Our finding suggests that urinary 2-HG is increased among patients with isocitrate dehydrogenases (IDH1 and IDH2) -mutant gliomas, and may represent a future surrogate, noninvasive biomarker to aid in diagnosis, prognosis, and management
26761588 The Isocitrate dehydrogenase is mutated at a key active site arginine residue (Arg172 in IDH2) in many cancers, leading to the synthesis of the oncometabolite (R)-2-hydroxyglutarate (2HG).
26669865 IDH2 mutation produced more 2-HG than IDH1 mutation.
26646705 Down regulation of IDH2 may promote HCC cell invasion via NF-x03BA;B-dependent increases in MMP9 activity. IDH2 may be a potential therapeutic target for HCC
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26558387 Most IDH mutant gliomas with TP53 mutations had at least one of the CNAs +7q, +8q, -9p, and -11p.
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in IDH2 promoter have now been identified in the majority of oligodendrogliomas
26486081 Data show that the monitoring of isocitrate dehydrogenase (NADP(+)) 1/2 IDH1/2 mutations showed that these mutations were reliable minimal residual disease (MRD) markers that allowed the prediction of relapse in the majority of patients.
26338964 Classification based on IDH1/2 mutation status and Ki-67 expression level could be more convenient for clinical application and guide personalized treatment in malignant gliomas.
26331834 The variant allelic frequencies in both IDH1 and IDH2 were equally low.
26314843 transcriptase (TERT) promoter mutations may predict enhanced sensitivity to genotoxic therapies in isocitrate dehydrogenase 1/2 (IDH1/2) wild-type WHO grade II and III diffuse gliomas.
26268241 IDH2R172 mutations define a unique subgroup of patients with angioimmunoblastic T-cell lymphoma.
26228814 IDH2 mutations are associated with myelodysplastic syndromes.
26194445 Glioblastomas with IDH1-m should be considered a different entity from the IDH1-wt, as their natural history and prognosis differ. In the near future we should be classified glioblastomas based on the presence of the IDH1 mutation
26189213 IDH1 and IDH2 mutations are negative prognostic markers in AML patients.
26158269 Data suggest that long-term survival in glioblastoma (GBM) patients is if at all only weakly correlated to isocitrate dehydrogenase 1 or 2 (IDH1/2) mutations.
26147657 IDH2 mutations and their functions in human tumors (review)
26125858 Our data could not confirm that mutations in IDH1/IDH2 are indicative of malignancy and prognosis.
26061753 Gliomas were classified into five principal groups on the basis of three tumor markers including IDH2. The groups had different ages at onset, overall survival, and associations with germline variants.
26046462 suggest that mutations in isocitrate dehydrogenases IDH1/2 lead to a local block in osteogenic differentiation during skeletogenesis causing the development of benign cartilaginous tumors.
26016821 The treatment outcome in acute myeloid leukemia patients with IDH1 and IDH2 mutations has been characterized.
26007236 Authors suggest 2HG as an analytic marker (in serum, urine, or biopsies) predicting malignancy of breast cancer in all patients.
25987093 IDH2 mutations are associated with normal cytogenetics and type A NPM1 mutations in Acute Myeloid Leukaemia.
25836588 data demonstrate important clinical and biological differences between IDH1(MT) and IDH2(MT) myeloid neoplasms
25818003 G6PD, GGCT, IDH1, isocitrate dehydrogenase 2 (NADP+,mitochondrial) (IDH2) and glutathione S-transferase pi 1(GSTP1), five of the critical components of GSH pathway, contribute to chemoresistance.
25811801 our data show that both mutant IDH1 and mutant IDH2 that, respectively, are expressed in cytosol and mitochondria, lead to decreased mitochondrial respiratory reserve
25783747 DNA-based molecular profiling of WHO grade II and III gliomas distinguishes biologically distinct tumor groups and provides prognostically relevant information beyond histological classification as well as IDH1/2 mutation and 1p/19q co-deletion status.
25652153 Isocitrate dehydrogenase (IDH) mutation is a valuable prognostic marker and a tool for decision-making for glioma treatment.
25651001 IDH1 and IDH2 mutations may predict a favorable response to DNA methyltransferase inhibitors in patients with acute myeloid leukemia.
25586680 The study of OxPhos-related genes revealed that an imbalance between the expression of IDH1 and IDH2, defined as overexpression of one isoform in relation to the other, was associated with worse prognosis in colorectal cancer patients.
25524848 IDH1/2 mutation occurs more frequently in low-grade glioma patients with seizure as an initial symptom, suggesting a potential relationship between this genetic phenotype and clinical seizure presentation
25495392 report of clinicopathological characteristics of the gliomas with IDH2 mutations including two cases of primary GBM carrying a novel missense IDH2 mutation (c. 484C>T, p. P162S)
25486927 The data suggest that IDH mutations are rare in the preleukemic disorders and may not be the major initial step in acute myeloid leukemia leukemogenesis.
25355558 IDH2 gene SNPs exhibited significant association with death risk in hepatocellular carcinoma patients.
25251602 When normalized with the respective WT-IDH cells, the general metabolic shifts of MT-IDH1 and IDH2 were almost opposite. Lactate level was lower in MT-IDH2 cells which produced more 2-HG than MT-IDH1 cells.
25078896 A review summarizes the function of mutated vs. wild-type IDH enzymes and the role of IDH2 mutations in gliomas.
25043045 transgenic mouse models expressing mutant human IDH in the adult liver show an aberrant response to hepatic injury, characterized by HNF-4alpha silencing, impaired hepatocyte differentiation, and markedly elevated levels of cell proliferation
25040869 IDH1 (R132) and IDH2 (R140, R172) mutations were not identified in any of the SCSTs: the mean coverage of the hotspot regions was 808 reads for IDH1 (R132), 944 for IDH2 (R140) and 1339 for IDH2 (R172)
25008158 Its mutation is strongly associated with pathological subtypes, genetic profiles, and clinical features in gliomas.(review)
24995286 we propose the TCM compounds, precatorine and abrine, as potential candidates as lead compounds for further study in drug development process with the IDH2 R140Q mutant protein against cancer
24993250 IDH2 mutation is associated with response to therapy in anaplastic astrocytoma.
24936872 IDH2 mutations are associated with myelodysplastic syndromes.
24898068 This is the first report to describe IDH mutations in giant cell tumors of bone (GCTBg), and MsMab-1 can be anticipated for use in immunohistochemical determination of IDH1/2 mutation-bearing GCTB.
24887488 Taken together, the hotspot mutations of IDH1, IDH2, DNMT3A, and MYD88 gene were absent in CRC. Aberrant mRNA expression of IDH1, DNMT3A, and MYD88 gene might be actively involved in the development of CRC.
24880135 Understanding of the biochemical consequences of IDH1/2 mutations in oncogenesis and survival prolongation will yield valuable information for rational therapy design [review]
24877111 These data refine current knowledge on IDH mutation prognostic impact and genotype-phenotype associations
24868540 IDH1/IDH2 but not TP53 mutations together with other prognostic factors such as age might be applied in clinical practice for prediction of outcome in patients with glioblastomas
24867810 The recent discoveries reported here help understanding of the role of the IDH1/2 mutations in chondrosarcomas. IDH mutational status serves as a molecular signature to differentiate chondrosarcomas from other sarcomas with cartilaginous element.
24860178 Isocitrate dehydrogenase 2 mutation is associated with infiltrative glioma.
24722048 Mutations in the IDH2 occurred mostly in astrocytomas, but were uncommon in glioblastomas.
24716838 IDH2 levels correlate with less aggressive tumor behavior in hepatocellular carcinoma.
24699305 the presence of DNMT3A, IDH1 or IDH2 mutations may confer sensitivity to novel therapeutic approaches, including the use of demethylating agents [review]
24606448 the frequency of DNMT3A and IDH1 mutation is lower to the worldwide incidence, while that of IDH2 is comparable.
24569570 Hotspot mutations in IDH isoforms 1 or 2 occur in approximately 15% of intrahepatic cholangiocarcinomas.
24549719 These results indicated lithium chloride could decrease the proliferation and migration potential of C6 glioma cells harboring IDH2 mutation.
24532263 we observed two mutations out of the usual hotspots at IDH1 and IDH2 genes in samples of pilocytic astrocytomas and grade-II astrocytomas pediatric patients.
24478380 This study indicates that circulating 2HG may be a surrogate biomarker of IDH1 or IDH2 mutation status in intrahepatic cholangiocarcinoma and that circulating 2HG levels may correlate directly with tumor burden
24460285 IDH2 mutations are not associated with glioma.
24443894 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24418992 Isocitrate dehydrogenase2 R140Q mutation induces myeloid and lymphoid neoplasms.
24403254 Isocitrate dehydrogenase 2 mutation is a frequent event in osteosarcoma.
24374336 We found significant signals of parallel evolution in IDH2 among these three groups
24333121 Inhibition of glutaminase selectively suppresses the growth of primary acute myeloid leukemia cells with IDH mutations.
24311631 IDH2 mutation is associated with gliomas and not malignant peripheral nerve sheath tumors.
24295421 Mutations in IDH1 and IDH2 have been discovered in glioma, acute myeloid leukemia and other solid tumors
24149775 study found 53.2 and 1.5 perc of anaplastic glioma patients in the study carried IDH1 and IDH2 mutation, respectively; there was higher proportion of MGMT promoter methylation, frontal lobe location and better outcome and lower proportion of temporal location in IDH-mutated samples; confirmed IDH mutation was a good prognosis marker for better outcome
24065766 neomorphic IDH2 mutations can be oncogenic in mesenchymal cells
23999441 This review discusses how mutations in IDH2 affect the leukemia epigenome, hematopoietic differentiation, and clinical outcome.
23996483 TET2 and IDH mutations did not have any significant impact on OS, while TET2 mutations were significantly associated with progression to sAML.
23918605 IDH2 mutation is associated with response to therapy in glioblastoma.
23894344 are potential prognostic biomarkers for gliomas
23877318 A review of the role of IDH2 mutations in the deregulation of cellular metabolism in glioma.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of isocitrate dehydrogenase 2 (IDH2) expression by HIV-1 Vpr in Vpr transduced macrophages
23689617 Transcriptomic analyses revealed CIMP-specific gene expression signatures, indicating the impact of genetic status (IDH mutation, 1p/19q codeletion, TP53 mutation) on gene expression, and pointing to candidate biomarkers in oligodendrogliomas.
23681562 The combination of IDH1/2 and 1p/19q codeletion is able to stratify anaplastic oligodendroglioma.
23641016 a firm association between IDH1, 2 mutations and serum 2HG concentration in AML
23598960 IDH1/2 mutation analysis appears to be a promising biomarker for the distinction of chondrosarcoma from chondroblastic osteosarcoma
23532369 Mutations in isocitrate dehydrogenase (IDH) 2 occur in the vast majority of low-grade gliomas and secondary high-grade gliomas.
23512379 A review of IDH2 mutations includes a discussion of how the mutations alter the catalytic properties.
23494632 suggest that IDH1/2 mutations have an impact on the glioma history of secondary glioblastoma with different genetic pathway
23451940 An IDH1 mutation is detected by molecular genetics in 37% (21/57) of glioma cases and no IDH2 mutations are detected.
23410661 IDH2 mutation is associated with gliomas.
23391413 Mutations of several oncogenes were identified in less than 50% of cholangiocarcinomas but when combined with IDH1/2 testing, more than 90% had a detectable mutation.
23373447 knowledge of the IDH mutation status has had significant translational implications, and diagnostic tools are being used to monitor its expression and function[Review]
23365461 Data indicate there were two patients carried ASXL1 mutations, both with t(8;21), 2 had DNMT3A mutations, 2 had IDH1 mutations, 1 had IDH2 mutation, and 3 had TET2 mutations.
23361564 IDH2 mutation is associated with glioma.
23330999 There are distinct IDH1/IDH2 and consequently distinct "triplenegative" patterns in purely insular versus paralimbic Grade II gliomas.
23264629 data demonstrate allelic and subcellular compartment differences can regulate the potential for IDH mutations to produce 2-hydroxyglutarate (2HG); consequences of 2HG elevation are dose-dependent and the non-equivalent 2HG accumulation resulting from IDH1 and IDH2 mutations may underlie their differential prognosis and prevalence in various cancers
23232569 The emerging concept is that IDH mutations result in tumor formation by epigenetic alterations that affect gene expression and result in inhibition of cellular differentiation.
23192014 mutations of IDH1/2 are of the same type and occur at the same frequency in therapy-related and de novo MDS and AML
23187294 IDH1/2 and DNMT3A mutation status was independent of GADD45A hyper-methylation in predicting acute myeloid leukemia survival.
23135354 epigenetics-modifying gene (DNMT3a, TET2 and IDH1/2) mutations had no change between diagnosis and relapse samples, and may become minimal residual disease marker
23115158 Overexpression of IDH2 mutant protein renders glioma cells more sensitive to radiation.
23111198 Mutations in IDH1 codon 132 or IDH2 codon 172 were identified in 31.2% of all screened cases and 46.2% of screened World Health Organization grade I to IV gliomas with mutations.
23074281 Data indicate that 2-hydroxyglutarate (2-HG) levels are significantly higher in isocitrate dehydrogenase (IDH1 and IDH2) mutant patients.
23071358 Abnormal histone and DNA methylation are emerging as a common feature of tumors with IDH1 and IDH2 mutations and may cause altered stem cell differentiation and eventual tumorigenesis.
23039322 Type and location of isocitrate dehydrogenase mutations influence clinical characteristics and disease outcome of acute myeloid leukemia.
23038259 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23015095 IDH2 mutations are frequent in secondary high-grade gliomas.
22929312 Patients with ASXL1 mutations did not harbor IDH1, FLT3, or CEBPA mutations, and a combination of ASXL1 and IDH2 mutations was found only in one patient with acute myeloid leukemia.
22922872 associations were observed for astrocytomas with mutated IDH1 or IDH2 but not for astrocytomas with wild-type IDH1 and IDH2.
22917530 These data suggest that IDH1/2 mutations constitute a distinct mutational class in acute myeloid leukemia[review]
22890969 IDH2 mutations are associated with grade II gliomas.
22825915 IDH2 mutation was a predictive factor of response to chemoradiotherapy in grade II gliomas
22824796 elucidated the consequences of IDH1 and IDH2 mutations on DNA methylation and gene expression in intrahepatic cholangiocarcinomas and glioblastomas; identified several genes with both increased DNA methylation and decreased gene expression that may represent candidate tumor suppressors
22790483 monitoring of the IDH1/2 status could be of value to predict the development of glioblastomas in patients with oligodendroglial tumors
22781800 The incidence of IDH1 and IDH2 mutation is higher in patients with de novo acute myeloid leukemia. IDH2 mutations are more frequent.
22687971 IDH1/2 gene mutations affected tumorigenesis
22683334 These results suggest that IDH1 and IDH2 have roles in production of D-2-hydroxyglutarate in cells.
22616558 Studies suggest that screening of IDH1/2 mutations could help to identify patients at high risk within some subsets.
22520341 IDH1 and IDH2 mutations are common genetic alterations in normal karyotype acute myeloid leukemia.
22503487 The results of this study show for the first time that isocitrate dehydrogenase 1 and 2 genes are mutated in cholangiocarcinoma
22494415 Data indicate there was a strong association of IDH2 mutation with NPM1 mutations and a trend with FLT3-internal-tandem duplication.
22427879 Gliomas of frontal origin had significantly higher incidence of 1p/19q co-deletion and IDH1/2 mutation than those of non-frontal origin, while gliomas of temporal origin had significantly lower incidence of 1p/19q co-deletion and IDH1/2 mutation than those of non-temporal origin.
22416140 SIRT3 protein deacetylates isocitrate dehydrogenase 2 (IDH2) and regulates mitochondrial redox status
22415316 IDH2 mutation followed by neuroglial developmental is associated with lower grade diffuse astrocytic glioma.
22410704 IDH2 mutation is associated with low-grade astrocytomas and their consecutive secondary high-grade gliomas.
22399191 IDH1/2 mutational status defines biologically different subgroups among gliomas[review]
22397365 IDH2 mutation is associated with acute myeloid leukemia.
22385606 90 adults with oral squamous cell carcinoma (OSCC)and 31 children with acute lymphoblastic leukemia (ALL) were scanned for IDH1 and IDH2 mutation hot spots; concluded that mutations of IDH are uncommon in ALL and OSCC
22360810 Reverse TCA cycle flux through isocitrate dehydrogenases 1 and 2 is required for lipogenesis in hypoxic melanoma cells.
22360629 This study used formalin-fixed paraffin-embedded and multiplex PCR and single-base extension to dection IDH 2 mutation in gliomas.
22343901 Introduction of either mutant IDH or cell-permeable 2HG was associated with repression of the inducible expression of lineage-specific differentiation genes and a block to differentiation.
22323113 IDH1/2 mutation status could be valuable for distinguishing intracranial chondrosarcomas from chordomas
22270848 No IDH2 mutations were found in 26 patients with gliosarcoma
22217666 In WHO grade II astrocytomas, IDH1/2 mutations mostly occur in tumors infiltrating the frontal lobe.
22215888 Data indicte that IDH2 mutations were identified in approximately 20% of angioimmunoblastic T-cell lymphomas (AITLs), but not in other peripheral T-cell lymphoma entities.
22180306 Mutations in IDH1 and IDH2 were found only in cholangiocarcinomas of intrahepatic origin (nine of 40, 23%) and in none of the 22 extrahepatic cholangiocarcinomas and none of the 25 gallbladder carcinomas.
22166653 Extraordinary high rates of somatic mutations in isocitrate dehydrogenase-1/2 occur in the majority of World Health Organization grade II and grade III gliomas as well as grade IV secondary glioblastomas[review]
22147457 catalyzes the oxidative decarboxylation of isocitrate into alpha-KG and its mutation have been frequently found in some types of gliomas. (review)
22136423 Mutations of IDH1 and IDH2 were found in 73 (29%) and 2 (1%) cases, respectively
22106302 Data show that the increased isocitrate dehydrogenase IDH2-dependent carboxylation of glutamine-derived alpha-ketoglutarate in hypoxia is associated with a concomitant increased synthesis of 2-hydroxyglutarate (2HG) in cells with wild-type IDH1 and IDH2.
22072542 Our detailed study of genetic aberrations in oligodendroglioma suggests a functional interaction between CIC mutation, IDH1/2 mutation, and 1p/19q co-deletion
22057236 The findings are compatible with a model in which IDH1 or IDH2 mutations represent early post-zygotic occurrences in individuals with these Ollier disease and Maffucci syndrome
22057234 Somatic mosaic IDH1 and IDH2 mutations are associated with enchondroma and spindle cell hemangioma in Ollier disease and Maffucci syndrome
22034964 in patients with secondary glioblastoma,IDH mutation, MGMT promoter methylation, and 1p19q codeletion were associated with prolonged progression-free survival in univariate and multivariate analysis;IDH mutation and MGMT promoter methylation were correlated with a higher rate of objective response to temozolomide
22033490 study examined the phenotypic and prognostic effects of IDH1 and IDH2 mutations among 277 patients with myelodysplastic syndromes (MDS); IDH mutations were detected in 34 cases: 26 IDH2 (all R140Q) and 8 IDH1 (6 R132S and 2 R132C); presence of IDH2R140Q did not affect the overall or leukemia-free survival
22020636 IDH aberrations and IDH1 codon 105 SNP occur in about 30% of younger patients with acute myeloid leukemia, mostly with diploid karyotype.
22002076 mechanisms of IDH mutations in gliomagenesis, and their value as diagnostic, prognostic marker and therapeutic target [review]
21997850 Data suggest that IDH1/2 mutations are recurrent but rare molecular aberrations in Chinese acute myeloid leukemia and myelodysplastic syndromes.
21996744 These data broaden our understanding of how IDH mutations may contribute to cancer through either neomorphic R(-)-2HG production or reduced wild-type enzymatic activity, and highlight the potential value of metabolite screening in identifying IDH-mutated tumors associated with elevated oncometabolite levels.
21904853 Data show that TET2 and ASXL1 pathogenic mutations are found in 8% of myeloproliferative neoplasms lacking JAK2 and MPL mutations, whereas IDH1, IDH2, and c-CBL mutations are not detected in this subset of patients.
21889589 High IDH2 is associated with d-2-hydroxyglutaric aciduria type II.
21885076 IDH1, more rarely IDH2, is mutated in 40% of gliomas (roughly 70% of low-grade gliomas, 50% of grade III, and 5 to 10% of primary glioblastomas--{REVIEW}
21874255 IDH2 mutations were associated with prolonged overall survival in glioma patients exclusive of pilocytic astrocytoma
21867611 IDH point mutations occur in acute myeloid leukemia patients with normal karyotypes but not in patients with abnormal karyotypes.
21741430 Results suggest that the suppression of IDPm activity resulted in the disruption of cellular redox balance and subsequently exacerbates EGCG-induced apoptotic cell death in HeLa cells.
21690245 Results suggest that TET2 promoter methylation, but not TET2 mutation, may be an alternative mechanism of pathogenesis in a small fraction of low-grade diffuse gliomas lacking IDH1/2 mutations.
21647154 Analysis of primary leukemic blasts confirmed high levels of 2-HG in AMLs with IDH1/IDH2 mutations. Interestingly, 3/5 AMLs with IDH2 mutations had FLT3-activating mutations, raising the possibility that these mutations cooperate in leukemogenesis.
21647152 analysis identified somatic IDH1/2 mutations in 4% of cases and the minor allele of single-nucleotide polymorphism (SNP) rs11554137 in 47 children (10.2%). IDH mutations were associated with an intermediate age, FAB M1/M2 and nucleophosmin1 mutations
21643985 we assessed the actual impact of IDH1 and IDH2 mutations in patients harboring WHO grade II and III gliomas.
21643842 IDH2 mutation is associated with brain tumors.
21625441 IDH2 mutation is not associated with glioblastoma.
21598255 report of IDH1 (R132) and IDH2 (R172) heterozygous mutations in conventional central and periosteal cartilaginous tumours; the mutations are restricted to these specific subtypes of cartilaginous tumours and not found in other connective tissue neoplasms
21596855 The presence of an IDH2(R172) mutation was associated with a significantly worse outcome than IDH2(R140), and relapse in FLT3/ITD(WT)NPM1(WT)IDH2(R172) patients was comparable with adverse-risk cytogenetics patients (76% and 72%, respectively).
21504050 IDH2 mutations were detected in 4/180 pediatric AML patients.
21480859 Acute myeloid leukaemia with cuplike nuclei is associated with a high incidence of IDH mutations (either IDH1 or IDH2).
21454467 Differential prognosis impact of IDH2 mutations in cytogenetically normal acute myeloid leukemia.
21383741 IDH1 AND IDH2 mutations have different prognostic effects when compared between AML and glioma
21346257 IDH2 mutation is asssociated with chronic myelogenous leukemia.
21326614 The fact that the gain of the enzymatic activity to produce 2 hydroxyglutarate is a shared feature of the IDH1 and IDH2 mutations suggests that this is an important function for these mutants in driving cancer pathogenesis.
21307773 Studies indicate that additional mutations in genes which appear to affect the epigenome of MPN patients have been discovered including mutations in TET2, IDH1/ 2, EZH2, and ASXL1.
21294161 IDH mutations are observed in approximately 70-80% of grade II/III gliomas and the majority of secondary glioblastomas, but only 10% of primary glioblastomas.
21289278 N-acetyl-aspartyl-glutamate (NAAG), a common dipeptide in brain, was 50-fold reduced in cells expressing IDH1 mutants and 8.3-fold reduced in cells expressing IDH2 mutants
21284999 the IDH mutations are not the origin of gliomas but a subsequent protective mechanism that interferes with the metabolism of the tumour cells, making these cells fragile and susceptible to cell death
21233841 Although uncommon in pediatric myeloid malignancies, IDH1 and IDH2 mutations, particularly IDH2 mutations, could contribute to the advanced phenotype of AML
21225914 IDH1 codon 132 or IDH2 codon 172 mutations or elevated 2-hydroxyglutarate levels do not play a role in the biology of sporadic Wilms tumors.
21173122 We conclude that IDH1(R)(1)(3)(2) and IDH2(R)(1)(2) mutations occur most often in cytogenetically normal acute myeloid leukemia cases with an overall frequency of approximately 11.8%.
21130701 Leukemic IDH1 and IDH2 mutations result in a hypermethylation phenotype, disrupt TET2 function, and impair hematopoietic differentiation.
21080178 Absence of IDH2 mutations in low grade gliomas (LGGs) identifies a novel entity of LGGs with distinctive location, infiltrative behavior, specific molecular alterations, and dismal outcome.
21080178 Observational study of gene-disease association. (HuGE Navigator)
21079611 Serial analyses of IDH2 mutations at both diagnosis and relapse in 121 patients confirmed high stability of IDH2 mutations. IDH2 mutation is a stable marker during disease evolution and confers favorable prognosis.
21079611 Observational study of gene-disease association. (HuGE Navigator)
21075857 Observational study of gene-disease association. (HuGE Navigator)
20975057 IDH mutation appears to be a significant marker of positive prognosis and chemosensitivity in low-grade gliomas, independently of 1p-19q codeletion, whereas its impact on the course of untreated tumors seems to be limited.
20975057 Observational study of gene-disease association. (HuGE Navigator)
20972461 review summarizes current understanding of the recently identified mutations in IDH1 and IDH2 and provide several potential molecular mechanisms linking them to malignant transformation [review]
20962862 IDH2 somatic mutations in chronic myeloid leukemia patients in blast crisis.
20962861 Observational study of gene-disease association. (HuGE Navigator)
20946881 The frequency of IDH1 and IDH2 missense mutations in Chinese AML patients reached 5.9% and 8.3%, respectively.
20946881 Observational study of gene-disease association. (HuGE Navigator)
20929327 IDH2 mutations in patients with acute myeloid leukemia: missense p.R140 mutations are linked to disease status.
20929327 Observational study of gene-disease association. (HuGE Navigator)
20929316 Correlation between IDH2 mutations and disease status in acute myeloid leukemia.
20880116 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20861910 a possible association between IDH mutations and trisomy 8 in myelodysplastic syndromes and acute myeloid leukemia.
20847235 study detected heterozygous germline mutations in IDH2 that alter enzyme residue Arg(140) in 15 unrelated patients with d-2-hydroxyglutaric aciduria
20713124 Results suggested that the suppression of HIF-1alpha accumulation by IDPm knockdown in PC3 cells was due to an inhibition of HIF-1alpha transcription.
20692206 IDH1 and IDH2 mutations are associated glioma and acute myeloid leukemia cases.[Review]
20678218 Mutations in IDH2 are associated with acute myeloid leukemias.
20678218 Observational study of gene-disease association. (HuGE Navigator)
20659156 serum 2-hydroxyglutarate concentrations were substantially increased in AML patients with both IDH1 and IDH2 mutations
20659156 Observational study of gene-disease association. (HuGE Navigator)
20625116 IDH2m were associated with a low WBC count at diagnosis and poor prognosis-lower response to chemotherapy and higher relapse and lower survival.
20625116 Observational study of gene-disease association. (HuGE Navigator)
20603105 Studies on the cell-lineages of tumors with IDH1/2 mutations may help clarify the role of these mutations in the development of brain tumors.
20603105 Observational study of gene-disease association. (HuGE Navigator)
20567020 IDH1 and IDH2 mutations are recurring genetic changes in acute myeloid leukemia (AML); they constitute a poor prognostic factor in cytogenetically normal-AML with mutated NPM1 without FLT3-internal tandem duplication
20567020 Observational study of gene-disease association. (HuGE Navigator)
20538800 In AML, IDH1 and IDH2 mutations are more common among AML with normal karyotype and NPM1(mutant) genotypes.
20538800 Observational study of gene-disease association. (HuGE Navigator)
20510884 IDH1 and IDH2 mutations are relevant to the progression of gliomas, prognosis and treatment of patients with gliomas harboring the mutation [review]
20508616 IDH2 mutations are associated with chronic-, fibrotic- or blast-phase essential thrombocythemia, polycythemia vera or myelofibrosis.
20508616 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20494930 Observational study of gene-disease association. (HuGE Navigator)
20485375 IDH2 mutations are associated with myelodysplastic syndrome and acute myeloid leukemia.
20465388 O(6)-methylguanine DNA methyltransferase (MGMT) status, and mutations of isocitrate dehydrogenases 1 and 2 (IDH1/IDH2) are currently the three most pertinent markers in diffuse gliomas [Review]
20427748 This study identified the IDH2 mutation status of a large series of gliomas analyzed by array-based comparative genomic hybridization (aCGH). We investigated whether the occurrence of IDH2 mutation correlates with 1p19q status.
20427748 Observational study of gene-disease association. (HuGE Navigator)
20421455 IDH2 mutations are frequently found in cytogenetically normal acute myeloid leukemia, but in our analysis these mutations did not influence treatment outcome.
20421455 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20410924 IDH2 gene mutation is associated with blast-phase myeloproliferative neoplasms.
20410924 Observational study of gene-disease association. (HuGE Navigator)
20376084 Mutations of IDH2 genes is associated with early and accelerated phases of myelodysplastic syndromes and myeloproliferative neoplasms.
20376084 Observational study of gene-disease association. (HuGE Navigator)
20368543 IDH1 and IDH2 mutations are recurrent in de novo cytogenetically normal acute myeloid leukemia and have an unfavorable impact on outcome.
20367200 Mutations in IDH seem to play an important role in the formation of specific subtypes of gliomas.
20171147 Some patients with cytogenetically normal acute myeloid leukemia and elevated 2-hydroxyglutarate possessed IDH2 mutations.
20160062 In 46% of cases with anaplastic oligodendroglioma an IDH1 mutation was found and only one IDH2 mutation was identified.
20142433 IDH2 mutation confer an enzymatic gain of function that dramatically increases 2-hydroxyglutarate in acute myelogenous leukemia
20131059 Observational study of gene-disease association. (HuGE Navigator)
19933982 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19915484 testing for IDH1/2 mutations can be effectively performed in a clinical setting and can enhance the accuracy of diagnosis of gliomas
19915015 IDH1 and 2 mutations are very rare in paragangliomas and pheochromocytomas and do not appear to play an important role in oncogenic HIF activation known to be present in these tumors.
19765000 IDH1 or IDH2 mutation plays a role in early tumor progression of several types of glioma
19765000 Observational study of gene-disease association. (HuGE Navigator)
19667985 Studies indicate that mutations in IDH1/IDH2 are specific for diffuse gliomas.
19554337 In patients with glioma, IDH2 mutations predominantly occur in oligodendroglial tumors.
19554337 Observational study of gene-disease association. (HuGE Navigator)
19530255 IDH2 codon 172 mutation is not associated with cancers.
19469031 Observational study of gene-disease association. (HuGE Navigator)
19350208 Mutations of IDH2 is not detected in brain metastases of colorectal cancer.
19228619 Mutations of NADP(+)-dependent isocitrate dehydrogenases encoded by IDH1 and IDH2 occur in a majority of several types of malignant gliomas.
18484410 HOCl-mediated damage to IDPm may result in the perturbation of the cellular antioxidant defense mechanisms and subsequently lead to a pro-oxidant condition
18096511 These results indicate that IDPm may play an important role in regulating the apoptosis induced by heat shock.
17854715 IDPm may play an important role in regulating apoptosis induced by TNF-alpha and anticancer drugs and the sensitizing effect of IDPm siRNA on the apoptotic cell death of HeLa cells offers the possibility of developing a modifier of cancer chemotherapy.

AA Sequence

MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTRIIWQFIKEKL      1 - 70
ILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR     71 - 140
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFKMVFTPKDGSGVKEWEVY    141 - 210
NFPAGGVGMGMYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK    211 - 280
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT    281 - 350
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH    351 - 420
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ                                          421 - 452
//

Text Mined References (244)

PMID Year Title
26945349 2016 Isocitrate Dehydrogenase (IDH)1/2 Mutations as Prognostic Markers in Patients With Glioblastomas.
26834160 2016 Elevation of Urinary 2-Hydroxyglutarate in IDH-Mutant Glioma.
26761588 2016 Photoactivation of Mutant Isocitrate Dehydrogenase 2 Reveals Rapid Cancer-Associated Metabolic and Epigenetic Changes.
26669865 2016 Noninvasive Quantification of 2-Hydroxyglutarate in Human Gliomas with IDH1 and IDH2 Mutations.
26646705 2015 Isocitrate Dehydrogenase 2 Suppresses the Invasion of Hepatocellular Carcinoma Cells via Matrix Metalloproteinase 9.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26558387 2015 PCR-Based Simple Subgrouping Is Validated for Classification of Gliomas and Defines Negative Prognostic Copy Number Aberrations in IDH Mutant Gliomas.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26486081 2015 IDH1/2 but not DNMT3A mutations are suitable targets for minimal residual disease monitoring in acute myeloid leukemia patients: a study by the Acute Leukemia French Association.
26338964 2015 IDH1/2 mutation status combined with Ki-67 labeling index defines distinct prognostic groups in glioma.
26331834 2015 Detection of Dual IDH1 and IDH2 Mutations by Targeted Next-Generation Sequencing in Acute Myeloid Leukemia and Myelodysplastic Syndromes.
26314843 2015 TERT promoter mutations contribute to IDH mutations in predicting differential responses to adjuvant therapies in WHO grade II and III diffuse gliomas.
26268241 2015 IDH2R172 mutations define a unique subgroup of patients with angioimmunoblastic T-cell lymphoma.
26228814 2016 IDH1 and IDH2 mutations in myelodysplastic syndromes and role in disease progression.
26194445 [Isocitrate dehydrogenase type I mutation as a prognostic factor in glioblastoma and a literature review].
26189213 2015 Prevalence and Clinical Effect of IDH1 and IDH2 Mutations Among Cytogenetically Normal Acute Myeloid Leukemia Patients.
26161668 2015 Mutant IDH1 Dysregulates the Differentiation of Mesenchymal Stem Cells in Association with Gene-Specific Histone Modifications to Cartilage- and Bone-Related Genes.
26158269 2015 IDH-Mutation Is a Weak Predictor of Long-Term Survival in Glioblastoma Patients.
26147657 2015 Role of isocitrate dehydrogenase 1/2 (IDH 1/2) gene mutations in human tumors.
26125858 2015 IDH1 and IDH2 mutations in different histologic subtypes and WHO grading gliomas in a sample from Northern Brazil.
26061753 2015 Glioma Groups Based on 1p/19q, IDH, and TERT Promoter Mutations in Tumors.
26046462 2015 The oncometabolite D-2-hydroxyglutarate induced by mutant IDH1 or -2 blocks osteoblast differentiation in vitro and in vivo.
26016821 2015 Characteristics, clinical outcome, and prognostic significance of IDH mutations in AML.
26007236 2015 Reductive carboxylation and 2-hydroxyglutarate formation by wild-type IDH2 in breast carcinoma cells.
25987093 2015 Mutation Analysis of IDH1/2 Genes in Unselected De novo Acute Myeloid Leukaemia Patients in India - Identification of A Novel IDH2 Mutation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25836588 2015 Clinical and biological implications of ancestral and non-ancestral IDH1 and IDH2 mutations in myeloid neoplasms.
25818003 2015 Identification of proteins responsible for adriamycin resistance in breast cancer cells using proteomics analysis.
25811801 2015 D-2-Hydroxyglutarate does not mimic all the IDH mutation effects, in particular the reduced etoposide-triggered apoptosis mediated by an alteration in mitochondrial NADH.
25783747 2015 Molecular classification of diffuse cerebral WHO grade II/III gliomas using genome- and transcriptome-wide profiling improves stratification of prognostically distinct patient groups.
25652153 2015 Diagnostic advantage of double immunohistochemistry using two mutation-specific anti-IDH antibodies (HMab-1 and MsMab-1) in gliomas.
25651001 2015 Presence of isocitrate dehydrogenase mutations may predict clinical response to hypomethylating agents in patients with acute myeloid leukemia.
25586680 2015 Mathematical analysis predicts imbalanced IDH1/2 expression associates with 2-HG-inactivating ?-oxygenation pathway in colorectal cancer.
25524848 2015 IDH1/2 mutation is associated with seizure as an initial symptom in low-grade glioma: A report of 311 Chinese adult glioma patients.
25495392 2015 IDH2 mutation in gliomas including novel mutation.
25486927 2015 Acquired somatic mutations of isocitrate dehydrogenases 1 and 2 (IDH1 and IDH2) in preleukemic disorders.
25355558 2014 Genetic variations in IDH gene as prognosis predictors in TACE-treated hepatocellular carcinoma patients.
25251602 2015 Metabolomic comparison between cells over-expressing isocitrate dehydrogenase 1 and 2 mutants and the effects of an inhibitor on the metabolism.
25078896 2014 Isocitrate dehydrogenase 1 and 2 mutations in gliomas.
25043045 2014 Mutant IDH inhibits HNF-4? to block hepatocyte differentiation and promote biliary cancer.
25040869 2015 Mutations in IDH1 and IDH2 are not present in sporadic ovarian sex cord-stromal tumours.
25008158 2015 IDH1/2 mutation detection in gliomas.
24995286 2014 Potential mitochondrial isocitrate dehydrogenase R140Q mutant inhibitor from traditional Chinese medicine against cancers.
24993250 2014 The impact of concurrent temozolomide with adjuvant radiation and IDH mutation status among patients with anaplastic astrocytoma.
24936872 2014 Prognostic value of isocitrate dehydrogenase mutations in myelodysplastic syndromes: a retrospective cohort study and meta-analysis.
24898068 2014 Isocitrate dehydrogenase mutation is frequently observed in giant cell tumor of bone.
24887488 2014 Mutation and expression analysis of the IDH1, IDH2, DNMT3A, and MYD88 genes in colorectal cancer.
24880135 2014 The driver and passenger effects of isocitrate dehydrogenase 1 and 2 mutations in oncogenesis and survival prolongation.
24877111 2014 IDH mutations: genotype-phenotype correlation and prognostic impact.
24868540 2014 IDH1/IDH2 but not TP53 mutations predict prognosis in Bulgarian glioblastoma patients.
24867810 2014 Isocitrate dehydrogenase mutations in chondrosarcoma: the crossroads between cellular metabolism and oncogenesis.
24860178 2014 Predicting the likelihood of an isocitrate dehydrogenase 1 or 2 mutation in diagnoses of infiltrative glioma.
24722048 2014 Mutations in IDH1, IDH2, and in the TERT promoter define clinically distinct subgroups of adult malignant gliomas.
24716838 2014 High expression of 5-hydroxymethylcytosine and isocitrate dehydrogenase 2 is associated with favorable prognosis after curative resection of hepatocellular carcinoma.
24699305 2014 DNMT3A and IDH mutations in acute myeloid leukemia and other myeloid malignancies: associations with prognosis and potential treatment strategies.
24606448 2014 Molecular evaluation of DNMT3A and IDH1/2 gene mutation: frequency, distribution pattern and associations with additional molecular markers in normal karyotype Indian acute myeloid leukemia patients.
24569570 2014 Mutations of isocitrate dehydrogenase 1 and 2 in intrahepatic cholangiocarcinoma.
24549719 2014 Lithium chloride decreases proliferation and migration of C6 glioma cells harboring isocitrate dehydrogenase 2 mutant via GSK-3?.
24532263 2014 Analysis of KIAA1549-BRAF fusion gene expression and IDH1/IDH2 mutations in low grade pediatric astrocytomas.
24478380 2014 Circulating oncometabolite 2-hydroxyglutarate is a potential surrogate biomarker in patients with isocitrate dehydrogenase-mutant intrahepatic cholangiocarcinoma.
24460285 2013 Molecular investigation of isocitrate dehydrogenase gene (IDH) mutations in gliomas: first report of IDH2 mutations in Indian patients.
24443894 2014 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24418992 2014 Isocitrate dehydrogenase (IDH)2 R140Q mutation induces myeloid and lymphoid neoplasms in mice.
24403254 2013 Isocitrate dehydrogenase 2 mutation is a frequent event in osteosarcoma detected by a multi-specific monoclonal antibody MsMab-1.
24374336 2014 Parallel evolution of IDH2 gene in cetaceans, primates and bats.
24333121 2014 Inhibition of glutaminase selectively suppresses the growth of primary acute myeloid leukemia cells with IDH mutations.
24311631 2014 Sequencing IDH1/2 glioma mutation hotspots in gliomas and malignant peripheral nerve sheath tumors.
24295421 2013 IDH mutations in tumorigenesis and their potential role as novel therapeutic targets.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24149775 2014 Correlation of IDH1/2 mutation with clinicopathologic factors and prognosis in anaplastic gliomas: a report of 203 patients from China.
24065766 2013 Induction of sarcomas by mutant IDH2.
23999441 2013 Isocitrate dehydrogenase mutations in leukemia.
23996483 2014 Clonal leukemic evolution in myelodysplastic syndromes with TET2 and IDH1/2 mutations.
23918605 2013 Long-term survival in primary glioblastoma with versus without isocitrate dehydrogenase mutations.
23894344 2013 IDH1/IDH2 mutations define the prognosis and molecular profiles of patients with gliomas: a meta-analysis.
23877318 2013 IDH1/2 mutations target a key hallmark of cancer by deregulating cellular metabolism in glioma.
23689617 2013 Codeletion of 1p and 19q determines distinct gene methylation and expression profiles in IDH-mutated oligodendroglial tumors.
23681562 2013 Combining two biomarkers, IDH1/2 mutations and 1p/19q codeletion, to stratify anaplastic oligodendroglioma in three groups: a single-center experience.
23641016 2013 Serum 2-hydroxyglutarate levels predict isocitrate dehydrogenase mutations and clinical outcome in acute myeloid leukemia.
23598960 2013 Molecular distinction of chondrosarcoma from chondroblastic osteosarcoma through IDH1/2 mutations.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532369 2013 IDH1 and IDH2 mutations in gliomas.
23512379 2013 What do we know about IDH1/2 mutations so far, and how do we use it?
23494632 2013 Secondary glioblastomas with IDH1/2 mutations have longer glioma history from preceding lower-grade gliomas.
23451940 2013 IDH mutation analysis in gliomas as a diagnostic and prognostic biomarker.
23410661 2013 Accumulation of 2-hydroxyglutarate is not a biomarker for malignant progression in IDH-mutated low-grade gliomas.
23391413 2013 Molecular profiling of cholangiocarcinoma shows potential for targeted therapy treatment decisions.
23373447 2013 From genomics to the clinic: biological and translational insights of mutant IDH1/2 in glioma.
23365461 2013 Cooperating gene mutations in childhood acute myeloid leukemia with special reference on mutations of ASXL1, TET2, IDH1, IDH2, and DNMT3A.
23361564 2013 Inherited variant on chromosome 11q23 increases susceptibility to IDH-mutated but not IDH-normal gliomas regardless of grade or histology.
23330999 2013 Distinct IDH1/IDH2 mutation profiles in purely insular versus paralimbic WHO Grade II gliomas.
23264629 2013 The potential for isocitrate dehydrogenase mutations to produce 2-hydroxyglutarate depends on allele specificity and subcellular compartmentalization.
23232569 2013 Mutations in the isocitrate dehydrogenase genes IDH1 and IDH2 in tumors.
23226729 2012 Altered expression levels of IDH2 are involved in the development of colon cancer.
23192014 2013 IDH1 and IDH2 mutations in therapy-related myelodysplastic syndrome and acute myeloid leukemia are associated with a normal karyotype and with der(1;7)(q10;p10).
23187294 2013 GADD45A methylation predicts poor overall survival in acute myeloid leukemia and is associated with IDH1/2 and DNMT3A mutations.
23135354 2013 Mutations of the epigenetics-modifying gene (DNMT3a, TET2, IDH1/2) at diagnosis may induce FLT3-ITD at relapse in de novo acute myeloid leukemia.
23115158 2013 Overexpression of isocitrate dehydrogenase mutant proteins renders glioma cells more sensitive to radiation.
23111198 2012 Pyrosequencing of IDH1 and IDH2 mutations in brain tumors and non-neoplastic conditions.
23074281 2012 Prospective serial evaluation of 2-hydroxyglutarate, during treatment of newly diagnosed acute myeloid leukemia, to assess disease activity and therapeutic response.
23071358 2012 IDH1 and IDH2 mutations in tumorigenesis: mechanistic insights and clinical perspectives.
23039322 2013 Type and location of isocitrate dehydrogenase mutations influence clinical characteristics and disease outcome of acute myeloid leukemia.
23038259 2012 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23015095 2012 The prognostic value of IDH mutations and MGMT promoter status in secondary high-grade gliomas.
22929312 2012 Rapid screening of ASXL1, IDH1, IDH2, and c-CBL mutations in de novo acute myeloid leukemia by high-resolution melting.
22922872 2012 A low-frequency variant at 8q24.21 is strongly associated with risk of oligodendroglial tumors and astrocytomas with IDH1 or IDH2 mutation.
22917530 2012 IDH mutations in acute myeloid leukemia.
22890969 2012 Molecular genetics of adult grade II gliomas: towards a comprehensive tumor classification system.
22825915 2012 IDH1/2 mutation is a prognostic marker for survival and predicts response to chemotherapy for grade II gliomas concomitantly treated with radiation therapy.
22824796 2013 Mutations in isocitrate dehydrogenase 1 and 2 occur frequently in intrahepatic cholangiocarcinomas and share hypermethylation targets with glioblastomas.
22790483 2012 Histopathological malignant progression of grade II and III gliomas correlated with IDH1/2 mutation status.
22781800 2012 [Analysis of IDH1 and IDH2 mutations in patients with acute myeloid leukemia].
22687971 2012 [IDH1/2 gene mutations in myelodysplastic syndromes].
22683334 2012 IDH1 and IDH2 have critical roles in 2-hydroxyglutarate production in D-2-hydroxyglutarate dehydrogenase depleted cells.
22616558 2012 Potential application of IDH1 and IDH2 mutations as prognostic indicators in non-promyelocytic acute myeloid leukemia: a meta-analysis.
22520341 2012 Adverse impact of IDH1 and IDH2 mutations in primary AML: experience of the Spanish CETLAM group.
22503487 2012 Isocitrate dehydrogenase 1 and 2 mutations in cholangiocarcinoma.
22494415 2012 IDH2 mutations are frequent in Chinese patients with acute myeloid leukemia and associated with NPM1 mutations and FAB-M2 subtype.
22427879 2012 Co-deletion of chromosome 1p/19q and IDH1/2 mutation in glioma subsets of brain tumors in Chinese patients.
22416140 2012 SIRT3 protein deacetylates isocitrate dehydrogenase 2 (IDH2) and regulates mitochondrial redox status.
22415316 2012 IDH mutation and neuroglial developmental features define clinically distinct subclasses of lower grade diffuse astrocytic glioma.
22410704 2012 IDH mutations as an early and consistent marker in low-grade astrocytomas WHO grade II and their consecutive secondary high-grade gliomas.
22399191 2012 Molecular pathogenesis of IDH mutations in gliomas.
22397365 2012 Molecular alterations of isocitrate dehydrogenase 1 and 2 (IDH1 and IDH2) metabolic genes and additional genetic mutations in newly diagnosed acute myeloid leukemia patients.
22385606 2012 Isocitrate dehydrogenase mutation hot spots in acute lymphoblastic leukemia and oral cancer.
22360810 2012 Reverse TCA cycle flux through isocitrate dehydrogenases 1 and 2 is required for lipogenesis in hypoxic melanoma cells.
22360629 2012 IDH mutation detection in formalin-fixed paraffin-embedded gliomas using multiplex PCR and single-base extension.
22343901 2012 IDH mutation impairs histone demethylation and results in a block to cell differentiation.
22323113 2012 Frequent IDH1/2 mutations in intracranial chondrosarcoma: a possible diagnostic clue for its differentiation from chordoma.
22270848 2012 Clinicopathologic and genomic features of gliosarcomas.
22217666 2012 IDH1/2 mutations in WHO grade II astrocytomas associated with localization and seizure as the initial symptom.
22215888 2012 IDH2 mutations are frequent in angioimmunoblastic T-cell lymphoma.
22180306 2012 Frequent mutation of isocitrate dehydrogenase (IDH)1 and IDH2 in cholangiocarcinoma identified through broad-based tumor genotyping.
22166653 2010 Analysis of isocitrate dehydrogenase-1/2 gene mutations in gliomas.
22147457 2011 [IDH1/2 mutations in gliomas].
22136423 2012 Significance of IDH mutations varies with tumor histology, grade, and genetics in Japanese glioma patients.
22106302 2011 Hypoxia promotes isocitrate dehydrogenase-dependent carboxylation of ?-ketoglutarate to citrate to support cell growth and viability.
22072542 2012 Concurrent CIC mutations, IDH mutations, and 1p/19q loss distinguish oligodendrogliomas from other cancers.
22057236 2011 Ollier disease and Maffucci syndrome are caused by somatic mosaic mutations of IDH1 and IDH2.
22057234 2011 Somatic mosaic IDH1 and IDH2 mutations are associated with enchondroma and spindle cell hemangioma in Ollier disease and Maffucci syndrome.
22034964 2012 IDH mutations predict longer survival and response to temozolomide in secondary glioblastoma.
22033490 2012 Differential prognostic effect of IDH1 versus IDH2 mutations in myelodysplastic syndromes: a Mayo Clinic study of 277 patients.
22020636 2012 Prognostic significance of alterations in IDH enzyme isoforms in patients with AML treated with high-dose cytarabine and idarubicin.
22002076 2011 Isocitrate dehydrogenase mutations in gliomas: mechanisms, biomarkers and therapeutic target.
21997850 2012 IDH1 and IDH2 mutation analysis in Chinese patients with acute myeloid leukemia and myelodysplastic syndrome.
21996744 2012 Identification of additional IDH mutations associated with oncometabolite R(-)-2-hydroxyglutarate production.
21904853 2012 TET2, ASXL1, IDH1, IDH2, and c-CBL genes in JAK2- and MPL-negative myeloproliferative neoplasms.
21889589 2011 A lymphoblast model for IDH2 gain-of-function activity in d-2-hydroxyglutaric aciduria type II: novel avenues for biochemical and therapeutic studies.
21885076 2011 Metabolism of glioma and IDH1/IDH2 mutations.
21874255 2011 IDH mutations occur frequently in Chinese glioma patients and predict longer survival but not response to concomitant chemoradiotherapy in anaplastic gliomas.
21867611 2011 [Isocitrate dehydrogenase gene mutations in acute myeloid leukemia].
21741430 2011 Attenuated mitochondrial NADP+-dependent isocitrate dehydrogenase activity enhances EGCG-induced apoptosis.
21690245 2011 TET2 promoter methylation in low-grade diffuse gliomas lacking IDH1/2 mutations.
21647154 2011 IDH1 and IDH2 mutations in pediatric acute leukemia.
21647152 2011 Prevalence and prognostic value of IDH1 and IDH2 mutations in childhood AML: a study of the AML-BFM and DCOG study groups.
21643985 2011 IDH mutation status impact on in vivo hypoxia biomarkers expression: new insights from a clinical, nuclear imaging and immunohistochemical study in 33 glioma patients.
21643842 2011 IDH1 and IDH2 mutations, immunohistochemistry and associations in a series of brain tumors.
21625441 2011 Screen for IDH1, IDH2, IDH3, D2HGDH and L2HGDH mutations in glioblastoma.
21598255 2011 IDH1 and IDH2 mutations are frequent events in central chondrosarcoma and central and periosteal chondromas but not in other mesenchymal tumours.
21596855 2011 The prognostic significance of IDH2 mutations in AML depends on the location of the mutation.
21504050 2011 Leukemic mutations in the methylation-associated genes DNMT3A and IDH2 are rare events in pediatric AML: a report from the Children's Oncology Group.
21480859 2011 High incidence of IDH mutations in acute myeloid leukaemia with cuplike nuclei.
21454467 2011 Differential prognosis impact of IDH2 mutations in cytogenetically normal acute myeloid leukemia.
21383741 2011 Metabolism unhinged: IDH mutations in cancer.
21346257 2011 CBL, CBLB, TET2, ASXL1, and IDH1/2 mutations and additional chromosomal aberrations constitute molecular events in chronic myelogenous leukemia.
21326614 2011 2-hydroxyglutarate production, but not dominant negative function, is conferred by glioma-derived NADP-dependent isocitrate dehydrogenase mutations.
21307773 2011 Genetics of the myeloproliferative neoplasms.
21294161 2011 Isocitrate dehydrogenase mutations: a challenge to traditional views on the genesis and malignant progression of gliomas.
21289278 2011 Profiling the effects of isocitrate dehydrogenase 1 and 2 mutations on the cellular metabolome.
21284999 2011 Isocitrate dehydrogenase mutations may be a protective mechanism in glioma patients.
21269460 2011 Initial characterization of the human central proteome.
21233841 2011 IDH1 and IDH2 mutations are rare in pediatric myeloid malignancies.
21225914 2011 Isocitrate dehydrogenase 1/2 mutational analyses and 2-hydroxyglutarate measurements in Wilms tumors.
21173122 2011 Acute myeloid leukemia with IDH1 or IDH2 mutation: frequency and clinicopathologic features.
21130701 2010 Leukemic IDH1 and IDH2 mutations result in a hypermethylation phenotype, disrupt TET2 function, and impair hematopoietic differentiation.
21080178 2010 Absence of IDH mutation identifies a novel radiologic and molecular subtype of WHO grade II gliomas with dismal prognosis.
21079611 2011 The prognostic impact and stability of Isocitrate dehydrogenase 2 mutation in adult patients with acute myeloid leukemia.
21075857 2010 Molecular classification of low-grade diffuse gliomas.
20975057 2010 IDH1 or IDH2 mutations predict longer survival and response to temozolomide in low-grade gliomas.
20972461 2010 Cancer-associated IDH mutations: biomarker and therapeutic opportunities.
20962862 2011 IDH2 somatic mutations in chronic myeloid leukemia patients in blast crisis.
20962861 2011 A nonsense mutation of IDH1 in myelodysplastic syndromes and related disorders.
20946881 2010 IDH1 and IDH2 mutations are frequent in Chinese patients with acute myeloid leukemia but rare in other types of hematological disorders.
20929327 2010 IDH2 mutations in patients with acute myeloid leukemia: missense p.R140 mutations are linked to disease status.
20929316 2010 Correlation between IDH2 mutations and disease status in acute myeloid leukemia.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20861910 2010 IDH mutations and trisomy 8 in myelodysplastic syndromes and acute myeloid leukemia.
20847235 2010 IDH2 mutations in patients with D-2-hydroxyglutaric aciduria.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20713124 2010 Modulation of hypoxia-inducible factor-1? expression by mitochondrial NADP+-dependent isocitrate dehydrogenase.
20692206 2010 IDH mutations in glioma and acute myeloid leukemia.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20659156 2010 Increased levels of 2-hydroxyglutarate in AML patients with IDH1-R132H and IDH2-R140Q mutations.
20625116 2010 Prognostic impact of isocitrate dehydrogenase enzyme isoforms 1 and 2 mutations in acute myeloid leukemia: a study by the Acute Leukemia French Association group.
20603105 2010 IDH1(R132) mutation identified in one human melanoma metastasis, but not correlated with metastases to the brain.
20567020 2010 IDH1 and IDH2 mutations are frequent genetic alterations in acute myeloid leukemia and confer adverse prognosis in cytogenetically normal acute myeloid leukemia with NPM1 mutation without FLT3 internal tandem duplication.
20538800 2010 Acquired mutations in the genes encoding IDH1 and IDH2 both are recurrent aberrations in acute myeloid leukemia: prevalence and prognostic value.
20510884 2010 Glioma-derived mutations in IDH: from mechanism to potential therapy.
20508616 2010 IDH1 and IDH2 mutation studies in 1473 patients with chronic-, fibrotic- or blast-phase essential thrombocythemia, polycythemia vera or myelofibrosis.
20494930 2010 IDH1 mutations in patients with myelodysplastic syndromes are associated with an unfavorable prognosis.
20485375 2010 Recurrent IDH mutations in high-risk myelodysplastic syndrome or acute myeloid leukemia with isolated del(5q).
20465388 2010 Prognostic markers in gliomas.
20427748 2010 All the 1p19q codeleted gliomas are mutated on IDH1 or IDH2.
20421455 2010 Prognostic impact of IDH2 mutations in cytogenetically normal acute myeloid leukemia.
20410924 2010 IDH1 and IDH2 mutation analysis in chronic- and blast-phase myeloproliferative neoplasms.
20376084 2010 Mutations of IDH1 and IDH2 genes in early and accelerated phases of myelodysplastic syndromes and MDS/myeloproliferative neoplasms.
20368543 2010 IDH1 and IDH2 gene mutations identify novel molecular subsets within de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
20367200 2010 2-hydroxyglutarate accumulation caused by IDH mutation is involved in the formation of malignant gliomas.
20171147 2010 The common feature of leukemia-associated IDH1 and IDH2 mutations is a neomorphic enzyme activity converting alpha-ketoglutarate to 2-hydroxyglutarate.
20160062 2010 IDH1 and IDH2 mutations are prognostic but not predictive for outcome in anaplastic oligodendroglial tumors: a report of the European Organization for Research and Treatment of Cancer Brain Tumor Group.
20142433 2010 Cancer-associated metabolite 2-hydroxyglutarate accumulates in acute myelogenous leukemia with isocitrate dehydrogenase 1 and 2 mutations.
20131059 2010 Rapid and sensitive assessment of the IDH1 and IDH2 mutation status in cerebral gliomas based on DNA pyrosequencing.
19933982 2009 IDH1 mutations in low-grade astrocytomas predict survival but not response to temozolomide.
19915484 2009 Diagnostic use of IDH1/2 mutation analysis in routine clinical testing of formalin-fixed, paraffin-embedded glioma tissues.
19915015 2010 Isocitrate dehydrogenase mutations are rare in pheochromocytomas and paragangliomas.
19765000 2009 Analysis of IDH1 and IDH2 mutations in Japanese glioma patients.
19667985 2009 Diagnostic and prognostic markers in gliomas.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19554337 2009 Type and frequency of IDH1 and IDH2 mutations are related to astrocytic and oligodendroglial differentiation and age: a study of 1,010 diffuse gliomas.
19530255 2009 Absence of IDH2 codon 172 mutation in common human cancers.
19469031 2009 IDH1 and IDH2 mutations in gliomas.
19350208 2009 Mutations of IDH1 and IDH2 are not detected in brain metastases of colorectal cancer.
19228619 2009 IDH1 and IDH2 mutations in gliomas.
18806796 2008 Insights from retinitis pigmentosa into the roles of isocitrate dehydrogenases in the Krebs cycle.
18484410 2008 Inactivation of mitochondrial NADP+-dependent isocitrate dehydrogenase by hypochlorous acid.
18096511 2008 Silencing of mitochondrial NADP+-dependent isocitrate dehydrogenase by small interfering RNA enhances heat shock-induced apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17854715 2007 Small interfering RNA-mediated silencing of mitochondrial NADP+-dependent isocitrate dehydrogenase enhances the sensitivity of HeLa cells toward tumor necrosis factor-alpha and anticancer drugs.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8954790 1996 Assignment of the human mitochondrial NADP(+)-specific isocitrate dehydrogenase (IDH2) gene to 15q26.1 by in situ hybridization.
8707889 1996 Expression of human mitochondrial NADP-dependent isocitrate dehydrogenase during lymphocyte activation.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
3363531 1988 Monoamine oxidase and other mitochondrial enzymes in density subpopulations of human platelets.
970033 1976 Regulation of progesterone biosynthesis in human placental mitochondria by Krebs cycle metabolites.
965003 1976 Assignment of a gene for human mitochondrial isocitrate dehydrogenase (ICD-M, EC 1.1.1.41) to chromosome 15.
752528 1978 Assignment of cytoplasmic alpha-mannosidase (MANA) and confirmation of mitochondrial isocitrate dehydrogenase (IDHM) to the q11 leads to qter region of chromosome 15 in man.
564083 1977 Somatic cell genetic assignment of the human gene for mitochondrial NADP-linked isocitrate dehydrogenase to the long arm of chromosome 15.
11969 1976 Human mitochondrial NADP-dependent isocitrate dehydrogenase in man-mouse somatic cell hybrids.