Property Summary

NCBI Gene PubMed Count 481
PubMed Score 1358.09
PubTator Score 1013.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Myelofibrosis 13 0.0 5.0

Expression

 IMPC Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (490)

PMID Text
26951332 treatment with a cell-permeable form of 2-HG sensitized wild-type IDH1 AML cells to ATRA-induced myeloid differentiation, whereas inhibition of 2-HG production significantly reduced ATRA effects in mutant IDH1 cells.
26945349 The IDH1 mutations are associated with improved survival in patients with Glioblastomas.
26936071 Data indicate a significant effect only in one scenario, the interaction between temozolomide (TMZ) and R132H mutations in isocitrate dehydrogenase (IDH1) on the overall survival of lower-grade glioma (LGG)
26927556 Data suggest mutant isocitrate dehydrogenase (IDH1)(R132H) might play a critical role in the cell proliferation and angiogenesis of glioma.
26834160 Our finding suggests that urinary 2-HG is increased among patients with isocitrate dehydrogenases (IDH1 and IDH2) -mutant gliomas, and may represent a future surrogate, noninvasive biomarker to aid in diagnosis, prognosis, and management
26700815 IDH mutations promote gliomagenesis by disrupting chromosomal topology and allowing aberrant regulatory interactions that induce oncogene expression.
26678339 Identify NAD+ depletion as a metabolic susceptibility of IDH1 mutant cancers.
26669865 IDH2 mutation produced more 2-HG than IDH1 mutation in human glioma.
26618343 Genomic alterations in IDH1-mutant glioma malignant progression
26617931 Case Report: right cerebellar pilocytic astrocytoma WHO grade I with an IDH1 R132H mutation.
26599207 Two novel loci IDH1 and ZGRF1 are associated with adiposity. [meta-analysis]
26582645 Mutations in isocitrate dehydrogenase 1 with high d-2-hydroxyglutarate serum levels are associated with acute myeloid leukemia.
26562302 Data show that tet methylcytosine dioxygenase 2 TET2, isocitrate dehydrogenases 1/2 IDH1/IDH2, serine/arginine-rich splicing factor 2 SRSF2, splicing factor 3b subunit 1 SF3B1, and ras proteins (KRAS/NRAS) are not conserved in dog mast Cell tumors.
26558387 Most IDH mutant gliomas with TP53 mutations had at least one of the CNAs +7q, +8q, -9p, and -11p.
26545048 With the advent of large-scale genome sequencing technology, molecular genetic alterations in IDH1 promoter have now been identified in the majority of oligodendrogliomas
26524630 alterations in genetic regulatory mechanisms may be the key factor for the major phenotypic changes in IDH1 mutated gliomas
26503470 Mutations in IDH1 gene conferred resistance to Temozolomide in glioblastoma.
26486081 Data show that the monitoring of isocitrate dehydrogenase (NADP(+)) 1/2 IDH1/2 mutations showed that these mutations were reliable minimal residual disease (MRD) markers that allowed the prediction of relapse in the majority of patients.
26485760 Data indicate that isocitrate dehydrogenase (NADP(+)) 1 (IDH1) mutation is a positive prognostic marker for low-grade glioma patients.
26414224 Case Report: combined "infiltrating astrocytoma/pleomorphic xanthoastrocytoma" harboring IDH1 R132H and BRAF V600E mutations.
26395639 mmunohistochemistry can be used for evaluation of ATRX loss, p53 protein accumulation and IDH1R132H mutation, which may allow a means of classification of astrocytoma outcome
26351014 IDH1105(GGT) minor allele has to be considered in the context of the genetic background of the individual AML analyzed.
26338964 Classification based on IDH1/2 mutation status and Ki-67 expression level could be more convenient for clinical application and guide personalized treatment in malignant gliomas.
26337623 The data of this study suggested the potential roles of lncRNA in gliomagenesis, and may help to understand the pathogenesis of gliomas associated with IDH1 mutation.
26331834 The variant allelic frequencies in both IDH1 and IDH2 were equally low.
26328938 IDH1 mutations occur in a restricted spectrum of tumors, including gliomas and acute myeloid leukemia.
26324126 Mutant IDH1 R132H decreased cell proliferation of U87 glioma cells by inducing the expression of the miRNA miR128a.
26316565 Tumor enhancement on postcontrast MR imaging is a valuable prognostic factor for patients with anaplastic glioma and IDH1 mutation
26314843 transcriptase (TERT) promoter mutations may predict enhanced sensitivity to genotoxic therapies in isocitrate dehydrogenase 1/2 (IDH1/2) wild-type WHO grade II and III diffuse gliomas.
26276726 The combined use of IDH1 mutation and MGMT methylation status can be used as prognostic markers for long-term survival of patients with cerebral low-grade glioma.
26243269 This study showed that the significance of IDH1 mutation is not clear in oligodendroglial tumors that are homogeneously indolent and chemosensitive.
26228814 IDH1 mutations are associated with myelodysplastic syndromes.
26189213 IDH1 and IDH2 mutations are negative prognostic markers in AML patients.
26185030 The pattern of mutations of IDH1, TP53 and MLH1 could play a role in the development and progression of radiation-induced glioma.
26161668 IDH1 R132C missense mutation contributes to the formation of cartilaginous tumors by dysregulating the chondrogenic and osteogenic differentiation of mesenchymal stem cells via gene-specific histone modulation.
26158269 Data suggest that long-term survival in glioblastoma (GBM) patients is if at all only weakly correlated to isocitrate dehydrogenase 1 or 2 (IDH1/2) mutations.
26147657 IDH1 mutations and their functions in human tumors (review)
26138051 IDH1 mutation is closely associated with treatment response in patients with recurrent anaplastic glioma treated with prolonged administration of temozolomide.
26125858 Our data could not confirm that mutations in IDH1/IDH2 are indicative of malignancy and prognosis.
26115961 IDH1/2 mutations were associated with central nervous system tumors.
26109200 CXCR7 influences prognosis in human glioma in an IDH1-dependent manner.
26095778 IDH1 promoter gene mutation found in adult patients diagnosed with gliomas.
26091668 This study demonstrated that the distinct molecular ontogeny between IDH (wt) and IDH (mut) gliomas and also support the novel findings that malignant progression of IDH (mut) gliomas to GBM involves increased genomic instability.
26061753 Gliomas were classified into five principal groups on the basis of three tumor markers including IDH1. The groups had different ages at onset, overall survival, and associations with germline variants.
26049021 IDH1, regulated by CHOP and C/EBPbeta in response to Endoplasmic Reticulum Stress treatment, inhibits survival of melanoma cells under hypoxia and promotes HIF-1alpha degradation.
26046462 Data suggest that mutations in isocitrate dehydrogenases IDH1/2 lead to a local block in osteogenic differentiation during skeletogenesis causing the development of benign cartilaginous tumors.
26045167 IDH1 mutation induces reprogramming of pyruvate metabolism, which is essential for cell proliferation and clonogenicity.
26022161 Correlation of 5hmC amount and molecular genetic markers of GBMs showed that there are no correlations of 5hmC amount and IDH1 mutations, MGMT promoter methylation, and LOH1p/19q
26016821 The treatment outcome in acute myeloid leukemia patients with IDH1 and IDH2 mutations has been characterized.
26008980 we have discovered a relationship between enhanced 5-ALA fluorescence and IDH1 mutations in WHO grade III gliomas. Low levels of NADPH in tumors with mutated IDH1 is responsible for the enhanced fluorescence.
26006098 Its mutated gene is expressed in gliomas.
25987093 IDH1 mutations are associated with normal cytogenetics and type A NPM1 mutations in Acute Myeloid Leukaemia.
25964481 Combined analysis of TERT, EGFR, and IDH status defines distinct prognostic glioblastoma classes.
25962792 The data show that IDH-mutant astrocytomas WHO grades II and III are much more similar in respect to age at presentation and overall survival than suggested by previous series not separated for IDH status.
25895133 Our results suggest that while mutations in IDH1 or-2 are an early event in tumorigenesis, chondrosarcoma is not dependent on mutant IDH1 anymore.
25862748 Ratio_2HG might be a predictor of the presence of IDH1 mutation. The measurement of 2HG could be useful for disease monitoring and also to assess the treatment effects in these patients
25849605 IDH1-R132H mutation is associated with anaplastic astrocytic tumors.
25836588 data demonstrate important clinical and biological differences between IDH1(MT) and IDH2(MT) myeloid neoplasms
25818003 G6PD, GGCT, IDH1, isocitrate dehydrogenase 2 (NADP+,mitochondrial) (IDH2) and glutathione S-transferase pi 1(GSTP1), five of the critical components of GSH pathway, contribute to chemoresistance.
25811801 our data show that both mutant IDH1 and mutant IDH2 that, respectively, are expressed in cytosol and mitochondria, lead to decreased mitochondrial respiratory reserve
25790191 these results corroborate the role of LOX in the migration, invasion and angiogenesis of astrocytomas. Furthermore, LOX expression is influenced by IDH1 mutational status.
25783747 DNA-based molecular profiling of WHO grade II and III gliomas distinguishes biologically distinct tumor groups and provides prognostically relevant information beyond histological classification as well as IDH1/2 mutation and 1p/19q co-deletion status.
25778530 Isocitrate dehydrogenase 1 mutation is associated with acute myeloid leukemia.
25732040 Case Report: glioblastoma adaptation traced through decline of an IDH1 clonal driver and macro-evolution of a double-minute chromosome.
25706986 IDH1 mutation leads to several, potentially translatable MRS-detectable metabolic changes beyond the production of 2-hydroxyglutarate
25701198 This study suggested that stratification of grade II-III gliomas into subsets defined by the presence or absence of IDH mutation leads to subgroups with distinct prognostic characteristics.
25678837 the latest progress in developing novel therapies against the IDH1 mutation is presented, including recent findings from ongoing phase 1 clinical trials and the exciting prospect of vaccine immunotherapy targeting the IDH1 mutant protein
25674227 We conclude that the majority of incidentally discovered low-grade gliomas are IDH1 mutated and are predominantly oligodendroglial tumors.
25652153 Isocitrate dehydrogenase (IDH) mutation is a valuable prognostic marker and a tool for decision-making for glioma treatment.
25651001 IDH1 and IDH2 mutations may predict a favorable response to DNA methyltransferase inhibitors in patients with acute myeloid leukemia.
25648147 FOXOs support the metabolic requirements of normal and tumor cells by promoting IDH1 expression.
25634750 Report predictive value of immunohistochemistry in detecting BRAF mutations in neoplasms.
25586680 The study of OxPhos-related genes revealed that an imbalance between the expression of IDH1 and IDH2, defined as overexpression of one isoform in relation to the other, was associated with worse prognosis in colorectal cancer patients.
25586175 These findings demonstrated that the IDH1R132H molecular target was involved in orchestrating the Warburg effect in mutant IDH1R132H glioma cells.
25555220 In situ PLA showed that the IDH1R132H epitope colocalizes with MHC class II in IDH1R132H-mutated glioma tissue.
25524848 IDH1/2 mutation occurs more frequently in low-grade glioma patients with seizure as an initial symptom, suggesting a potential relationship between this genetic phenotype and clinical seizure presentation
25523507 Study shows that high IDH1 expression is associated with a poor prognosis for acute myeloid leukemia with normal cytogenetic status suggesting it as an independent prognosis factor for cytogenetically normal acute myeloid leukemia.
25511738 Data indicate that focal adhesion pathway is significantly downregulated in isocitrate dehydrogenase 1 (IDH1)-mutant glioblastomas.
25496513 Isocitrate dehydrogenase 1 R132C mutation occurs exclusively in microsatellite stable colorectal cancers with the CpG island methylator phenotype.
25486927 The data suggest that IDH mutations are rare in the preleukemic disorders and may not be the major initial step in acute myeloid leukemia leukemogenesis.
25455102 IDH1 mutation, but not MGMT hypermethylation is prognostic for primary glioblastoma multiforme
25432631 p16/CDKN2A copy number variation occurs subsequent to the IDH1 mutation, and confirm that p16/CDKN2A copy number variation occurs in 75% of high grade central chondrosarcomas
25407774 Anaplastic oligodendrogliomas with necrosis/glioblastoma mainly demonstrated IDH1 R132H expression and intact 1p/19q.
25391653 These results show that targeting a divalent cation binding residue can enable selective inhibition of mutant IDH1
25355558 SNPs in IDH1 gene exhibited significant association with death risk in hepatocellular carcinoma patients.
25283382 Our study provides direct evidence that the improved survival in patients with IDH1-R132H tumors may partly result from the effects of the IDH1-R132H protein on chemosensitivity
25277207 Our study showed for the first time a cooperative reduction in clonogenicity in cells co-expressing IDH1-R132H and mutant CIC proteins
25251602 When normalized with the respective WT-IDH cells, the general metabolic shifts of MT-IDH1 and IDH2 were almost opposite. The metabolic effect of an IDH1 mutant inhibitor was limited to 2-HG lowering.
25243911 PC and PDH may be an important part of cellular adaptation to the IDH1 mutation and may serve as potential therapeutic targets
25225364 IDH1(R132H) exhibits a growth-inhibitory effect that is abrogated in the presence of glutamate dehydrogenase 2 (GLUD2), a hominoid-specific enzyme purportedly optimized to facilitate glutamate turnover in human forebrain.
25170661 The IDH1 mutation was more common in supplementary motor area region tumors compared with other brain
25164322 Results of this study suggest that IDH1 mutation may be associated with polysialic acid expression pathways in malignant gliomas.
25155243 IDH mutation is a central and defining event in the development and progression of glioma and may be a key target for future therapies for these types of neoplasms.
25150284 the absence of both EGFR amplification and TERT promoter mutations is associated with longer survival in patients with glioblastomas
25135281 The present data indicates a new function of mutant IDH1 in gliomas-the suppression of Par-4 expression.
25078896 A review summarizes the function of mutated vs. wild-type IDH enzymes and the role of IDH1 mutations in gliomas.
25043045 transgenic mouse models expressing mutant human IDH in the adult liver show an aberrant response to hepatic injury, characterized by HNF-4alpha silencing, impaired hepatocyte differentiation, and markedly elevated levels of cell proliferation
25040869 IDH1 (R132) and IDH2 (R140, R172) mutations were not identified in any of the SCSTs: the mean coverage of the hotspot regions was 808 reads for IDH1 (R132), 944 for IDH2 (R140) and 1339 for IDH2 (R172)
25035396 Mutant IDH1 drives a unique set of transformative events.
25033601 the frequency of detected cytogenetic aberrations MYC/MYCN, EGFR and PDGRFA, homozygous deletion of the CDKN2A gene, and deletion of the PTEN gene, pediatric glioblastomas bear analogy to the subgroup of IDH1-mutant glioblastomas in adults.
25029120 we demonstrate that IDH1 mutations are identified in inflammatory bowel disease-associated intestinal adenocarcinoma but not in sporadic intestinal adenocarcinoma
25008768 The data of this study suggest that anaplastic gliomas can be grouped by IDH and 1p/19q status into three molecular groups that show clear links to underlying biology and a significant association with clinical outcome in a prospective trial cohort.
25008158 Its mutation is strongly associated with pathological subtypes, genetic profiles, and clinical features in gliomas.(review)
25005896 IDH1-R132H mutation alters phospholipid metabolism in gliomas.
24993250 IDH1 mutation is associated with response to therapy in anaplastic astrocytoma.
24986863 studies provide a dynamic mechanistic basis for metabolic alterations observed in IDH1-mutated tumors and uncover potential therapeutic targets in IDH1-mutated cancers
24970694 Overexpression HIF1alpha was related with higher expressions of CXCR7 and CXCR4, otherwise IDH1 mutation related with lower expression of both genes in astrocytomas.
24958096 Patients with anaplastic gliomas without IDH mutation experienced distant recurrence and exhibited glioma stem cell markers, indicating that this subset may share some malignant characteristics with glioblastomas.
24936872 IDH1 mutations are associated with myelodysplastic syndromes.
24922649 IDH1(R132H)mutation is associated with spontaneous in vitro senescence of glioma cells.
24903073 This study supports the hypothesis that this mutation may play a role in the pathogenesis of both tumor associated epilepsy and low grade gliomas.
24898068 This is the first report to describe IDH mutations in giant cell tumors of bone (GCTBg), and MsMab-1 can be anticipated for use in immunohistochemical determination of IDH1/2 mutation-bearing GCTB.
24895549 These data suggest that IDH1 (R132H) mutation increases radiosensitivity in mild hypoxic conditions.
24889502 This study show that PCR assay for one-step detection of 12 IDH1/2 mutations in glioma.
24887488 Taken together, the hotspot mutations of IDH1, IDH2, DNMT3A, and MYD88 gene were absent in CRC. Aberrant mRNA expression of IDH1, DNMT3A, and MYD88 gene might be actively involved in the development of CRC.
24880135 Understanding of the biochemical consequences of IDH1/2 mutations in oncogenesis and survival prolongation will yield valuable information for rational therapy design [review]
24877111 These data refine current knowledge on IDH mutation prognostic impact and genotype-phenotype associations
24868540 IDH1/IDH2 but not TP53 mutations together with other prognostic factors such as age might be applied in clinical practice for prediction of outcome in patients with glioblastomas
24867810 The recent discoveries reported here help with understanding of the role of IDH1/2 mutations in chondrosarcomas. IDH mutational status serves as a molecular signature to differentiate chondrosarcomas from other sarcomas with cartilaginous element.
24860178 Isocitrate dehydrogenase 1 mutation is associated with infiltrative glioma.
24857351 report of a new IDH1 mutation associated with BRAF mutation in a very unusual glial tumor.
24847087 The spontaneous velocity of diametric expansion and isocitrate dehydrogenase 1 mutation status are 2 independent prognostic values that should be obtained at the beginning of the management of diffuse low-grade gliomas in adults
24771584 Study shows an inverse correlation between mutant IDH1 and markers for active PI3K/Akt signaling.
24760710 This may suggest future avenues for disease monitoring through noninvasive measurement of 2-HG, as well as for the development and study of targeted therapies against the aberrant IDH1 enzyme.
24755473 Under hypoxic conditions, IDH1-mutant cells exhibited increased oxidative tricarboxylic acid metabolism along with decreased reductive glutamine metabolism.
24722048 Mutations in the IDH1 occurred mostly in astrocytomas, but were uncommon in glioblastomas.
24699305 the presence of DNMT3A, IDH1 or IDH2 mutations may confer sensitivity to novel therapeutic approaches, including the use of demethylating agents [review]
24626950 Mutation of isocitrate dehydrogenase 1 induces glioma cell proliferation via nuclear factor-kappaB activation in a hypoxia-inducible factor 1-alpha dependent manner
24606448 the frequency of DNMT3A and IDH1 mutation is lower to the worldwide incidence, while that of IDH2 is comparable.
24590270 glutaminolysis is activated in gliomas with IDH1-R132H mutation.
24569570 Hotspot mutations in IDH isoforms 1 or 2 occur in approximately 15% of intrahepatic cholangiocarcinomas.
24565682 IDH1 mutations are recurring genetic alterations in acute myeloid leukemia and they may have unfavorable impact on clinical outcome.
24557705 Fractional anisotropy and ADC from DTI can noninvasively detect IDH1 R132H mutation in astrogliomas.
24532263 we observed two mutations out of the usual hotspots at IDH1 and IDH2 genes in samples of pilocytic astrocytomas and grade-II astrocytomas pediatric patients.
24531386 IDH1 p.R132 mutations are not associated with hepatocellular carcinoma in a sample of 87 Han Chinese patients.
24529257 he results of this study suggest natural selection against the rare IDH1R132 mutations in human glioma due to toxicity caused by high levels of D-2-hydroxyglutarate.
24511544 Studied the prognostic role of IDH1 R132H mutation in Glioblastoma multiforme patients in West Bohemia.
24510240 The combination of IDH1 mutations and MGMT methylation outperforms either IDH1 mutations or MGMT methylation alone in predicting survival of glioblastoma patients.
24478380 This study indicates that circulating 2HG may be a surrogate biomarker of IDH1 or IDH2 mutation status in intrahepatic cholangiocarcinoma and that circulating 2HG levels may correlate directly with tumor burden
24473683 investigated differences in protein expression levels in IDH1(R132H) mutant versus IDH1 wild type grade III gliomas; alphaB-crystallin proteins are elevated in IDH1(R132H) mutant tumors; expression appears to be controlled at post-translational level; most abundant form of alphaB-crystallin is a low molecular weight C-terminally truncated form
24460285 High IDH1 mutations are associated with glioma.
24443894 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24405933 gliomas with IDH1 mutation normalize their glucose metabolism, which appears to result in a slower tumor progression.
24384677 Its mutation has been identified as early and frequent genetic alterations in lowgrade glioma.
24376688 IDH1 non-arginine132 mutations occurred frequently in newly diagnosed adult Chinese acute myeloid leukemia patients, but these mutations do not correlate with the overall survival.
24368190 we observed in vitro anti-proliferation and pro-apoptosis effects of up-regulated IDH1 on osteosarcoma cell lines and IDH1 up-regulation also suppressed tumor growth and metastasis in vivo
24362902 Mutation of IDH1 inhibits growth of glioma cells, this might be major factor behind its association with prolonged survival in glioma.Depletion of GSH and generation of ROS are the primary cellular events associated with this mutation.
24333121 Inhibition of glutaminase selectively suppresses the growth of primary acute myeloid leukemia cells with IDH mutations.
24324372 IDH1 mutation was frequently detected in low-grade gliomas, and it may result in tumor-related seizures.
24311631 IDH1 mutation is associated with gliomas and not malignant peripheral nerve sheath tumors.
24305719 IDH1 mutant gliomas were more amenable to resection.
24295421 Mutations in IDH1 and IDH2 have been discovered in glioma, acute myeloid leukemia and other solid tumors
24286310 The knockdown of IDPc expression by RNA interference enhances UVB-induced apoptosis of immortalized human HaCaT keratinocytes.
24160898 IDH1 mutations are associated with treatment response in malignant glioma.
24149775 study found 53.2 and 1.5 perc of anaplastic glioma patients in the study carried IDH1 and IDH2 mutation, respectively; there was higher proportion of MGMT promoter methylation, frontal lobe location and better outcome and lower proportion of temporal location in IDH-mutated samples; confirmed IDH mutation was a good prognosis marker for better outcome
24129546 IDH1 mutation is associated with glioblastomas.
24089051 7.4% of 27 cystic glioblastoma multiforme tumor samples were documented as having IDH1 mutations.
24077277 Metabolic changes induced by the IDH1 mutation enhance p21 expression via SREBP1 and inhibit phosphorylation of Rb,slowing the cell cycle. It may be associated with non-aggressive glioma features.
24068788 In gliomas without IDH1 mutation, O(6)-methylguanine-DNA methyltransferase (MGMT) promoter methylation has predictive value.
24046070 High Plasma IDH1 levels were associated with non-small cell lung cancer.
24019001 alpha-ketoglutarate can serve as a metabolic imaging agent for non-invasive, real-time, in vivo monitoring of mutant IDH1 activity, and can inform on IDH1 status.
24004584 IDH mutation analysis may significantly aid in the diagnosis and differential diagnoses of gliomas in Chinese patients
23999441 This review discusses how mutations in IDH1 affect the leukemia epigenome, hematopoietic differentiation, and clinical outcome.
23996483 TET2 and IDH mutations did not have any significant impact on OS, while TET2 mutations were significantly associated with progression to sAML.
23988086 IDH1 mutation-specific miRNA signature is a marker for favorable prognosis in primary GBM patients with the IDH1 wild type.
23954893 IDH1 has oncogenic activity and a role in promoting leukemogenesis
23934769 The presence or absence of the R132H mutation in IDH1 can help pathologists to distinguish pilocytic astrocytomas (IDH1 WT) from diffuse ones (R132H IDH1/WT).
23934175 cMYC may be associated with a unique clinicopathologic and biologic group of infiltrating gliomas and help mediate the malignant transformation of IDH1 mutant gliomas.
23918605 IDH1 mutation is associated with response to therapy in glioblastoma.
23904262 Studies indicate that isocitrate dehydrogenase 1 (IDH1) mutation is an independent prognostic factor for patients with glioblastoma and IDH1 mutation is associated with improved overall survival.
23894344 IDH mutations are potential prognostic biomarkers for gliomas
23877318 A review of the role of IDH1 mutations in the deregulation of cellular metabolism in glioma.
23840696 patients with IDH1 mutated gliomas had a significantly longer progression-free survival and overall survival.
23817809 Mutated IDH1 is associated with response to treatment in gliomas.
23801081 IDH1 mutant R132H sensitizes glioma cells to BCNU-induced oxidative stress and cell death.
23793099 BCAT1 expression was suppressed by ectopic overexpression of mutant IDH1 in immortalized human astrocytes, providing a link between IDH1 function and BCAT1 expression.
23737489 Isocitrate dehydrogenase 1 mutation is associated with glioma.
23731180 We propose that the sum of these kinetic changes allows the mutant IDH1 enzymes to reductively trap aKG directly into 2HG, rather than allowing it to react with carbon dioxide and form isocitrate, as occurs in the wild-type enzyme.
23689617 Transcriptomic analyses revealed CIMP-specific gene expression signatures, indicating the impact of genetic status (IDH mutation, 1p/19q codeletion, TP53 mutation) on gene expression, and pointing to candidate biomarkers in oligodendrogliomas.
23681562 The combination of IDH1/2 and 1p/19q codeletion is able to stratify anaplastic oligodendroglioma.
23641016 a firm association between IDH1, 2 mutations and serum 2HG concentration in AML
23598960 IDH1/2 mutation analysis appears to be a promising biomarker for the distinction of chondrosarcoma from chondroblastic osteosarcoma
23581583 Isocitrate dehydrogenase 1 (IDH1) mutations have been discovered to be frequent and highly conserved in secondary glioblastoma multiforme and lower-grade gliomas.
23561624 Newly developed sensitive methods, such as the PNA-clamping method and multiplex PCR with SBE assay, are practically useful in addition to the conventional IDH1 IHC in small biopsied samples.
23558169 data suggest that mutant IDH1 may promote glioma growth through mechanisms beyond its well-characterized epigenetic effects
23532369 Mutations in isocitrate dehydrogenase (IDH) 1 occur in the vast majority of low-grade gliomas and secondary high-grade gliomas.
23512379 A review of IDH1 mutations includes a discussion of how the mutations alter the catalytic properties.
23504258 IDH mutation is associated with response to therapy in gliomas.
23494873 IDH1 mutation is associated with glioblastoma multiforme.
23494632 suggest that IDH1/2 mutations have an impact on the glioma history of secondary glioblastoma with different genetic pathway
23486690 IDH1 mutations are associated with gliomas.
23486687 1p/19q codeletion and IDH1/2 mutation is associated with anaplastic oligoastrocytomas and oligodendrogliomas.
23485734 20 of 28 (71%) spindle cell hemangiomas harbored mutations in exon 4 of IDH1 or IDH2.
23451940 Both Grade II gliomas and anaplastic astrocytomas show a statistically different distribution of IDH1 mutation load compared to glioblastomas.
23451042 IDH1-associated primary glioblastoma in young adults displays differential patterns of tumour and vascular morphology.
23438035 This study demonistrared that IDH1 mutation not releate to glioblastoma.
23429602 MGMT promoter methylation and/or IDH1 mutation generally signified a better prognosis for patients with a diffuse glioma
23412777 oligodendroglial component (GBMO) may represent a subgroup of GBM that is associated with IDH1 mutation and younger age, although similar to classic GBM in prognosis
23410661 IDH1 mutation is associated with gliomas.
23391413 Mutations of several oncogenes were identified in less than 50% of cholangiocarcinomas but when combined with IDH1/2 testing, more than 90% had a detectable mutation.
23373447 concept of IDH1-mutant versus IDH1-wild type will become a critical early distinction in diagnostic and treatment algorithms [review]
23365461 Data indicate there were two patients carried ASXL1 mutations, both with t(8;21), 2 had DNMT3A mutations, 2 had IDH1 mutations, 1 had IDH2 mutation, and 3 had TET2 mutations.
23361564 IDH1 mutation is associated with glioma.
23358936 IDH1 mutation is associated with glioma.
23330999 There are distinct IDH1/IDH2 and consequently distinct "triplenegative" patterns in purely insular versus paralimbic Grade II gliomas.
23307057 we characterize four rare and novel IDH1 mutations identified in surgical human glioma samples
23264629 data demonstrate allelic and subcellular compartment differences can regulate the potential for IDH mutations to produce 2-hydroxyglutarate (2HG); consequences of 2HG elevation are dose-dependent and the non-equivalent 2HG accumulation resulting from IDH1 and IDH2 mutations may underlie their differential prognosis and prevalence in various cancers
23236540 This population-based study could not demonstrate IDH1 status to be an independent prognostic factor in high-grade gliomas
23235339 The IDH1 arginine132histidine mutation has been found in 72% astrocytoma patients and 2.5% prostate carcinoma patients.
23232569 The emerging concept is that IDH mutations result in tumor formation by epigenetic alterations that affect gene expression and result in inhibition of cellular differentiation.
23223340 High frequency of IDH1 mutations are associated with primary glioblastoma.
23204232 Expression of wild-type IDH1 was also critical for mutant IDH1-associated D-2HG production in the colorectal cancer
23192014 mutations of IDH1/2 are of the same type and occur at the same frequency in therapy-related and de novo MDS and AML
23187294 IDH1/2 and DNMT3A mutation status was independent of GADD45A hyper-methylation in predicting acute myeloid leukemia survival.
23184331 an association between the IDH1 SNP rs11554137:C>T polymorphism and adverse outcomes in patients with malignant glioma
23135354 epigenetics-modifying gene (DNMT3a, TET2 and IDH1/2) mutations had no change between diagnosis and relapse samples, and may become minimal residual disease marker.
23115158 Overexpression of IDH1 mutant protein renders glioma cells more sensitive to radiation.
23111198 Examination of the relationship between the mutation status and other pertinent variables demonstrated a significant male predominance among IDH1-mutated gliomas.
23079654 show that each H3F3A mutation defines an epigenetic subgroup of glioblastoma with a distinct global methylation pattern, and that they are mutually exclusive with IDH1 mutations
23074281 Data indicate that 2-hydroxyglutarate (2-HG) levels are significantly higher in isocitrate dehydrogenase (IDH1 and IDH2) mutant patients.
23072665 IDH1 mutation is an early and common event especially in the development of oligodendroglial tumors
23071358 Abnormal histone and DNA methylation are emerging as a common feature of tumors with IDH1 and IDH2 mutations and may cause altered stem cell differentiation and eventual tumorigenesis.
23064941 It is the enzyme involved in lipid metabolism and glucose sensing, has been identified in gliomas. Thus it is a tumor marker for the cancer.
23063752 This study demonstrates that IDH mutation is a reliable surrogate marker for identifying malignant gliomas with an operant Hedgehog pathway.
23053494 It mutations are powerful prognostic factors in patients with primary glioblastoma in the medulla oblongata.
23041832 Report role of IDH1 immunostaining pattern in diagnosing rare and glioblastoma variants.
23039322 Type and location of isocitrate dehydrogenase mutations influence clinical characteristics and disease outcome of acute myeloid leukemia.
23038259 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23035067 With a specificity of 100% and a sensitivity related to the tumor volume and contrast enhancement, IDH1 identification has a valuable diagnostic accuracy in patients not amenable to biopsy
23015095 IDH1 mutations are frequent in secondary high-grade gliomas.
23011765 The findings indicated that R132H mutational IDH1 is involved in the regulation of proliferation, growth, and migration of glioma cells.
22968464 In primary myelofibrosis patients, IDH mutations clustered with SRSF2 mutations and were associated independently with poor outcome.
22945896 Diagnoses of the 18 IDH1 mutation-positive cases were revised as oligodendroglioma, oligoastrocytoma, or astrocytoma
22929312 Patients with ASXL1 mutations did not harbor IDH1, FLT3, or CEBPA mutations, and a combination of ASXL1 and IDH2 mutations was found only in one patient with acute myeloid leukemia.
22922872 associations were observed for astrocytomas with mutated IDH1 or IDH2 but not for astrocytomas with wild-type IDH1 and IDH2.
22922798 IDH1 mutation was an independent positive prognostic factor in low-grade oligodendrogliomas and anaplastic oligodendrogliomas, especially in the absence of p53 overexpression
22917530 These data suggest that IDH1/2 mutations constitute a distinct mutational class in acute myeloid leukemia[review]
22904127 Our study validates IDH1 mutant protein expression across various grades of astrocytoma, and demonstrates a high incidence of IDH1 mutations in DA, AA, and secondary GBM
22899282 Global and gene-specific histone lysine methylation modifications correlate with DNA methylation and gene expression alterations in IDH1R132H/WT cells.
22890969 IDH1 mutations are associated with grade II gliomas.
22885298 study reports that selective suppression of endogenous mutant IDH1 expression in HT1080, a fibrosarcoma cell line with a native IDH1(R132C) heterozygous mutation, significantly inhibits cell proliferation and decreases clonogenic potential
22869205 Analysis allowed us to define two highly recurrent genetic signatures in gliomas: IDH1/ATRX (I-A) and IDH1/CIC/FUBP1 (I-CF).
22868530 None of the cases was immunopositive for IDH1 and EGFR. p53 protein expression was observed in three cases with 25-30 % of cells showing weak to moderate staining.
22844452 role of IDH1 mutation in recurrent astrocytic, oligoastrocytic and oligodendroglial tumors
22825915 IDH1 mutation was a predictive factor of response to chemoradiotherapy in grade II gliomas
22824796 elucidated the consequences of IDH1 and IDH2 mutations on DNA methylation and gene expression in intrahepatic cholangiocarcinomas and glioblastomas; identified several genes with both increased DNA methylation and decreased gene expression that may represent candidate tumor suppressors
22809434 results suggested that the IDH1 R132 mutation might be a recurrent gene alteration in ALL; patients carrying the mutation have a trend to aberrantly express myeloid antigen and the mutation may imply a dismal outcome
22790483 monitoring of the IDH1/2 status could be of value to predict the development of glioblastomas in patients with oligodendroglial tumors
22785212 a significant portion of CD68(+), Iba1(+), CX3CR1(+) microglial cells/macrophages also harbor the IDH1R132H mutation.
22781800 The incidence of IDH1 and IDH2 mutation is higher in patients with de novo acute myeloid leukemia. IDH2 mutations are more frequent.
22781348 The different frequencies of IDH1 mutation in different subsets of oligodendroglial tumors may imply varied tumorigenic pathways between subsets.
22772980 low rate of R312H IDH1 mutation in grade II and III diffuse gliomas
22772731 This study demonistrated that IDH1 mutations showed wide regulation of angiogenesis and genome-wide change of histone and DNA methylation.
22763442 this study is the first to describe the generation and characterization of conditional IDH1(R132H)-KI mice, and also the first report to demonstrate the induction of a leukaemic DNA methylation signature in a mouse model; this report thus sheds light on t
22752663 Its mutation as apotential novel biomarker for distinguishing pseudoprogression from true progression in patients with glioblastoma.
22748659 Overview of IDH1 function, prognostic value in human gliomas, and potential as a therapeutic target. [Review Article]
22688054 The loss of 5-hydroxymethylcytosine is a frequent event in gliomas, independent of IDH1 mutation, and may be influenced by the nuclear exclusion of TET1 from the nuclei of glioma cells.
22687971 IDH1/2 gene mutations affected tumorigenesis
22683334 These results suggest that IDH1 and IDH2 have roles in production of D-2-hydroxyglutarate in cells.
22668828 Studies suggest cancer stem cells CD133 and isocitrate dehydrogenase (IDH) mutation could be prognostic factors in glioblastoma.
22616558 Studies suggest that screening of IDH1/2 mutations could help to identify patients at high risk within some subsets.
22528790 IDH1 mutations are not associated with WHO grade II astrocytomas
22520341 IDH1 and IDH2 mutations are common genetic alterations in normal karyotype acute myeloid leukemia.
22503487 The results of this study show for the first time that isocitrate dehydrogenase 1 and 2 genes are mutated in cholangiocarcinoma
22445362 3 angiocentric glioma cases were all negative for the presence of IDH1 R132H mutant protein.
22432788 Our results indicate that there is no IDH1 gene involvement in the onset and progression of pediatric astrocytomas.
22427879 Gliomas of frontal origin had significantly higher incidence of 1p/19q co-deletion and IDH1/2 mutation than those of non-frontal origin, while gliomas of temporal origin had significantly lower incidence of 1p/19q co-deletion and IDH1/2 mutation than those of non-temporal origin.
22415316 IDH1 mutation followed by neuroglial developmental is associated with lower grade diffuse astrocytic glioma.
22410704 IDH1 mutation is associated with low-grade astrocytomas and their consecutive secondary high-grade gliomas.
22399191 IDH1/2 mutational status defines biologically different subgroups among gliomas[review]
22397365 IDH1 mutation is associated with acute myeloid leukemia.
22396073 IDH-1 mutation is associated with oligodendroglioma.
22396072 IDH1 mutations are associated with glial tumors.
22392125 The results of this study provided first evidence that IDH1 mutations are not significantly involved in tumor growth rate.
22385606 90 adults with oral squamous cell carcinoma (OSCC)and 31 children with acute lymphoblastic leukemia (ALL) were scanned for IDH1 and IDH2 mutation hot spots; concluded that mutations of IDH are uncommon in ALL and OSCC
22360810 Reverse TCA cycle flux through isocitrate dehydrogenases 1 and 2 is required for lipogenesis in hypoxic melanoma cells.
22360629 This study used formalin-fixed paraffin-embedded and multiplex PCR and single-base extension to dection IDH 1 mutation in gliomas.
22343901 Introduction of either mutant IDH or cell-permeable 2HG was associated with repression of the inducible expression of lineage-specific differentiation genes and a block to differentiation.
22343889 IDH mutation is the molecular basis of CpG island methylator phenotype (CIMP) in gliomas
22326863 The glioblastoma with oligodendroglioma component group showed higher frequency of IDH1 mutation (31% vs. <5%, P= .015).
22323113 IDH1/2 mutation status could be valuable for distinguishing intracranial chondrosarcomas from chordomas
22322613 Imaging features in glioma are potentially predictive of IDH1 mutational status but were poorly correlated with MGMT promoter methylation.
22291938 Kaplan-Meier survival analysis revealed a highly significant association between IDH1 mutation and a better clinical outcome.
22281465 MGMT promoter methylation and IDH1 mutation might be favorable factors for long-term survival in glioblastoma multiforme patients.
22270848 MGMT methylation and IDH1 mutation are rare events in gliosarcomas
22264756 Suggest that decreased IDPc expression renders melanocytes more vulnerable to oxidative stress, and IDPc plays an important antioxidant function in melanocytes.
22238333 These data provide extensive characterization of mutant IDH1 lesions while confirming the potential diagnostic value of D-2-hydroxyglutarate as a surrogate marker of patient survival.
22238332 Optimized in vivo spectral-editing and two-dimensional (2D) correlation magnetic resonance spectroscopy (MRS) methods were used to unambiguously detect 2-hydroxyglutarate noninvasively in glioma patients with IDH1 mutations.
22217666 In WHO grade II astrocytomas, IDH1/2 mutations mostly occur in tumors infiltrating the frontal lobe.
22199315 IDH1 mutation may correlate with the benefit from VEGF(R)- versus EGFR-targeted therapy at the time of recurrence in glioma patients
22197544 IDH1-R132H mutation status in nonenhancing diffuse glioma of older adults is a poor prognostic factor
22192702 Loss of chromosome 1p/19q and isocitrate dehydrogenase 1(IDH1) mutations were not identified in both cases
22180306 In an analysis of frozen tissue specimens, IDH1 mutation was associated with highly elevated tissue levels of the enzymatic product 2-hydroxyglutarate.
22172803 an association between the R132H IDH1 mutation and intermediate risk cytogenetics in AML, suggesting that R132H IDH1 mutation may be associated with improved clinical outcome
22166653 Extraordinary high rates of somatic mutations in isocitrate dehydrogenase-1/2 occur in the majority of World Health Organization grade II and grade III gliomas as well as grade IV secondary glioblastomas[review]
22147457 catalyzes the oxidative decarboxylation of isocitrate into alpha-KG and its mutation have been frequently found in some types of gliomas. (review)
22144470 Data show that monoallelic expression (MAE) at TP53 exists only in mutated tumors and increases with tumor aggressiveness, and MAE toward the normal allele at IDH1 conferred worse survival even in IDH1 mutated tumors.
22136423 we analyzed mutations of IDH1 and IDH2 in 250 glioma cases
22113362 IDH1 mutation is a somatic mutation that is found only in some glioma subtypes.
22106302 Data show that the increased isocitrate dehydrogenase IDH2-dependent carboxylation of glutamine-derived alpha-ketoglutarate in hypoxia is associated with a concomitant increased synthesis of 2-hydroxyglutarate (2HG) in cells with wild-type IDH1 and IDH2.
22101433 isocitrate dehydrogenase-1 (IDH1)-dependent pathway is active in most cell lines under normal culture conditions, but cells grown under hypoxia rely almost exclusively on reductive carboxylation of glutamine-derived alpha-ketoglutarate for de novo lipogenesis
22076165 Glioblastoma with PNET-like components has a higher frequency of isocitrate dehydrogenase 1 mutation and likely a better prognosis than primary glioblastoma.
22074484 in contrast to enchondromas, central chondrosarcomas, and periosteal cartilaginous tumours, IDH1 mutations do not occur in these entities
22072542 Our detailed study of genetic aberrations in oligodendroglioma suggests a functional interaction between CIC mutation, IDH1/2 mutation, and 1p/19q co-deletion
22064513 up-regulation of isocitrate dehydrogenase 1 is associated with non-small cell lung cancer.
22057236 The findings are compatible with a model in which IDH1 or IDH2 mutations represent early post-zygotic occurrences in individuals with these Ollier disease and Maffucci syndrome
22057234 Somatic mosaic IDH1 and IDH2 mutations are associated with enchondroma and spindle cell hemangioma in Ollier disease and Maffucci syndrome
22052461 Data indicate that in brain tumors, 5hmdC showed an even more drastic reduction with levels up to more than 30-fold lower than in normal brain, but 5hmdC levels were independent of mutations in isocitrate dehydrogenase-1.
22034964 in patients with secondary glioblastoma, IDH mutation, MGMT promoter methylation, and 1p19q codeletion were associated with prolonged progression-free survival in univariate and multivariate analysis; IDH mutation and MGMT promoter methylation were correlated with a higher rate of objective response to temozolomide
22033490 study examined the phenotypic and prognostic effects of IDH1 and IDH2 mutations among 277 patients with myelodysplastic syndromes (MDS); IDH mutations were detected in 34 cases: 26 IDH2 (all R140Q) and 8 IDH1 (6 R132S and 2 R132C); study suggests the adverse prognostic effect of mutant IDH1 on both overall and leukemia-free survival in MDS
22025298 Somatic mutations in IDH1 play a role in urinary excretion of D-2-hydroxy-glutaric acid.
22020636 IDH aberrations and IDH1 codon 105 SNP occur in about 30% of younger patients with acute myeloid leukemia, mostly with diploid karyotype.
22015945 IDH1 mutation is associated with glioma.
22002076 mechanisms of IDH mutations in gliomagenesis, and their value as diagnostic, prognostic marker and therapeutic target [review]
21997850 Data suggest that IDH1/2 mutations are recurrent but rare molecular aberrations in Chinese acute myeloid leukemia and myelodysplastic syndromes.
21996744 These data broaden our understanding of how IDH mutations may contribute to cancer through either neomorphic R(-)-2HG production or reduced wild-type enzymatic activity, and highlight the potential value of metabolite screening in identifying IDH-mutated tumors associated with elevated oncometabolite levels.
21983902 R132H mutation of isocitrate dehydrogenase 1 is an independent prognostic factor in anaplastic astrocytoma.
21955925 Our article may provide guidance for laboratories aiming at establishing IDH testing for diagnostic evaluation of primary brain tumors.
21929658 Mutations of IDH1 were strongly correlated with both increased overall survival (OS) and progression-free survival (PFS) in patients with type 2 gliomatosis cerebri.
21922591 MGMT promoter methylation, analyzed by pyrosequencing, is a frequent event in oligodendroglial tumors, and it correlates with IDH1 mutation and 19q loss in gliomas.
21912393 Observations suggest that isocitrate dehydrogenase mutations in primary myelofibrosis are independent predictors of leukemic transformation and raise the possibility of leukemogenic collaboration with JAK2V617F.
21910919 IDH-1 mutations, but not MGMT promoter methylation, may be associated with increased overall survival in glioblastoma
21904853 Data show that TET2 and ASXL1 pathogenic mutations are found in 8% of myeloproliferative neoplasms lacking JAK2 and MPL mutations, whereas IDH1, IDH2, and c-CBL mutations are not detected in this subset of patients.
21898821 Oligodendrogliomas with a mutant IDH1 had noteworthy enhanced expression of enzymes controlling aerobic glycolysis and detoxification, and anti-apoptosis proteins.
21885076 IDH1, more rarely IDH2, is mutated in 40% of gliomas (roughly 70% of low-grade gliomas, 50% of grade III, and 5 to 10% of primary glioblastomas--{REVIEW}
21874255 IDH1 mutations also occur freuqently in Chinese glioma patients but the frequency of IDH1 mutations is below the findings reported by North American and European groups
21873548 The clinical profile of SNP-positive patients suggests that SNP rs11554137 may have biologic effects that bear further investigation.
21867611 IDH point mutations occur in acute myeloid leukemia patients with normal karyotypes but not in patients with abnormal karyotypes.
21845536 our results indicate that IDHR132H mutation correlates significantly with p53 and inversely with EGFR mutations
21784755 IDH1 mutation is associated with gliomas.
21781445 Detection of IDH1 mutations or the status of the MGMT promoter on a biopsy sample could be of major diagnostic and prognostic importance for distinguishing secondary from primary glioblastomas and to predict a more favourable prognosis.
21755347 This study demonistrated that High frequency of IDH-1 mutation links glioneuronal tumors with neuropil-like islands to diffuse astrocytomas.
21717448 IDH1 mutations are associated with a Janus headlike phenomenon; unfavorable prognostic influence on PFS turns into favorable impact on postrecurrence survival.
21707716 IDH1R132H mutations occur almost exclusively in glioma and acute myeloid leukaemia.
21690245 Results suggest that TET2 promoter methylation, but not TET2 mutation, may be an alternative mechanism of pathogenesis in a small fraction of low-grade diffuse gliomas lacking IDH1/2 mutations.
21647154 Analysis of primary leukemic blasts confirmed high levels of 2-HG in AMLs with IDH1/IDH2 mutations. Interestingly, 3/5 AMLs with IDH2 mutations had FLT3-activating mutations, raising the possibility that these mutations cooperate in leukemogenesis
21647152 analysis identified somatic IDH1/2 mutations in 4% of cases and the minor allele of single-nucleotide polymorphism (SNP) rs11554137 in 47 children (10.2%). IDH mutations were associated with an intermediate age, FAB M1/M2 and nucleophosmin1 mutations
21643985 we assessed the actual impact of IDH1 and IDH2 mutations in patients harboring WHO grade II and III gliomas.
21643842 IDH1 mutation is associated with brain tumors.
21625441 IDH1 mutation is not associated with glioblastoma.
21598255 report of IDH1 (R132) and IDH2 (R172) heterozygous mutations in conventional central and periosteal cartilaginous tumours; the mutations are restricted to these specific subtypes of cartilaginous tumours and not found in other connective tissue neoplasms
21575384 IDH1 R132H tends to express preferentially in low-grade gliomas.
21569770 IDH1 mutations in codon 132 were observed in 46% cases of glioma.
21539821 The aim of the present study was to explore the reliability of the high-resolution melting analysis (HRMA) for the identification of IDH1 R132 mutations in acute myeloid leukemia.
21516462 Combined expression of IDH1(R132H) and INA was strongly associated with response to chemotherapy in gliomas
21506885 protection of the kidney afforded by ischemic pre-conditioning may be associated with increased activity of IDH1 which relates to increased levels of NADPH, increased ratios of glutathione/total glutathione
21481010 IDH1 mutations were detected only in gliomatosis cerebri of adult patients
21480859 Acute myeloid leukaemia with cuplike nuclei is associated with a high incidence of IDH mutations (either IDH1 or IDH2).
21437454 We found IDH1 mutations in 11.8% (19 out of 161) of samples tested, with a higher mutation rate in glyoblastomas diagnosed as secondary, 66.7% (4 out of 6), than in cases of primary GBMs, 9.7% (15 out of 155), p<0.001.
21383741 IDH1 AND IDH2 mutations have different prognostic effects when compared between AML and glioma
21356389 IDH1 mutation works with other oncogenic mutations and could contribute to the metastasis in melanoma.
21346257 IDH1 mutation is asssociated with chronic myelogenous leukemia.
21343879 The best overall sensitivity is achieved when fluorescence in situ hybridization for chromosome 7 gain is added to the p53-mutant IDH1 immunohistochemistry panel
21326614 The fact that the gain of the enzymatic activity to produce 2-hydroxyglutarate is a shared feature of the IDH1 and IDH2 mutations suggests that this is an important function for these mutants in driving cancer pathogenesis.
21326241 Glioma cells showing IDH1 mutation cannot be propagated in standard cell culture conditions.
21316759 For acute myeloid leukemia with AML1-ETO fusion gene, isocitrate dehydrogenase (IDH1mut) patients may have worse disease-free survival than IDH1wild-type Chinese patients.
21314850 This study present evidence supporting testing for IDH1 mutations in all gangliogliomas of adults, especially those adult tumors in a nontemporal location and/or containing
21307773 Studies indicate that additional mutations in genes which appear to affect the epigenome of MPN patients have been discovered including mutations in TET2, IDH1/ 2, EZH2, and ASXL1.
21301070 Developed is a mathematical model of IDH1 mutated secondary glioblastoma using evolutionary game theory to investigate the interactions between four different phenotypic populations within the tumor.
21294161 IDH mutations are observed in approximately 70-80% of grade II/III gliomas and the majority of secondary glioblastomas, but only 10% of primary glioblastomas
21289278 N-acetyl-aspartyl-glutamate (NAAG), a common dipeptide in brain, was 50-fold reduced in cells expressing IDH1 mutants and 8.3-fold reduced in cells expressing IDH2 mutants
21284999 the IDH mutations are not the origin of gliomas but a subsequent protective mechanism that interferes with the metabolism of the tumour cells, making these cells fragile and susceptible to cell death
21233841 Although uncommon in pediatric myeloid malignancies, IDH1 and IDH2 mutations, particularly IDH2 mutations, could contribute to the advanced phenotype of AML
21225914 IDH1 codon 132 or IDH2 codon 172 mutations or elevated 2-hydroxyglutarate levels do not play a role in the biology of sporadic Wilms tumors.
21181477 This study suggested that R132H-mutation of isocitrate dehydrogenase-1 is not sufficient for HIF-1alpha upregulation in adult glioma.
21177338 MGMT promoter methylation and IDH1 mutations are associated with response to temozolomide chemotherapy.
21173122 We conclude that IDH1(R)(1)(3)(2) and IDH2(R)(1)(2) mutations occur most often in cytogenetically normal acute myeloid leukemia cases with an overall frequency of approximately 11.8%.
21163902 the homogeneity of methylation classes for gliomas with IDH mutation, despite their histological diversity, suggests that IDH mutation is associated with a distinct DNA methylation phenotype and an altered metabolic profile in glioma
21130701 Leukemic IDH1 and IDH2 mutations result in a hypermethylation phenotype, disrupt TET2 function, and impair hematopoietic differentiation.
21088844 In a combined set of anaplastic astrocytomas and glioblastomas, both IDH1 mutation and IDH1 expression status are of greater prognostic relevance than histological diagnosis.
21088844 Observational study of gene-disease association. (HuGE Navigator)
21083371 This study independently verifies the influence of NCOR2 and IDH1 on HIV transmission, and its findings suggest that variation in these genes affects susceptibility to HIV infection in exposed individuals.
21080178 Observational study of gene-disease association. (HuGE Navigator)
21079649 Teh mutant IDH1 dimer is unable to convert isocitrate to alpha ketoglutarate in a way similar to wild type IDH1.
21079611 Observational study of gene-disease association. (HuGE Navigator)
21075857 Observational study of gene-disease association. (HuGE Navigator)
21069360 This studydemonstrated that the vast majority of adult oligodendrogliomas and oligoastrocytomas have mutations of IDH1(R132H mutation).
21045145 Data show that the ability to selectively slow growth in cells with IDH1 mutations by inhibiting glutaminase suggesting a unique reprogramming of intermediary metabolism and a potential therapeutic strategy.
20975740 The R132H mutation hinders the conformational changes from the initial ICT-binding state to the pre-transition state, leading to the impairment of the IDH activity.
20975057 IDH mutation appears to be a significant marker of positive prognosis and chemosensitivity in low-grade gliomas, independently of 1p-19q codeletion, whereas its impact on the course of untreated tumors seems to be limited.
20975057 Observational study of gene-disease association. (HuGE Navigator)
20972461 review summarizes current understanding of the recently identified mutations in IDH1 and IDH2 and provide several potential molecular mechanisms linking them to malignant transformation [review]
20962861 A nonsense mutation of IDH1 in myelodysplastic syndromes and related disorders.
20962861 Observational study of gene-disease association. (HuGE Navigator)
20946881 The frequency of IDH1 and IDH2 missense mutations in Chinese AML patients reached 5.9% and 8.3%, respectively.
20946881 Observational study of gene-disease association. (HuGE Navigator)
20944672 Low prevalence of IDH1 gene mutation in childhood AML in Italy.
20880116 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20874727 we identified three cases of a predicted, but so far never described mutation in codon 100 of IDH1 in gliomas
20805365 IDH1 mutations are associated with acute myeloid leukemia.
20805365 Observational study of gene-disease association. (HuGE Navigator)
20725730 IDH1 mutations are common in malignant gliomas in older children
20702649 Sequence alignment across several species shows that all IDH1 genetic alterations occur at evolutionarily conserved residues located within the active site, and therefore, are likely to affect protein function.
20702649 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20692206 IDH1 and IDH2 mutations are associated glioma and acute myeloid leukemia cases. [Review]
20678218 Mutations in IDH1 are associated with acute myeloid leukemias.
20678218 Observational study of gene-disease association. (HuGE Navigator)
20667415 DNA MUTATIONAL ANALYSIS OF 132 NON-HODGKINS LYMPHOMA PATIENTS SHOWED NO MUTATION IN IDH1
20667415 Observational study of gene-disease association. (HuGE Navigator)
20661018 As IDH mutations are not characteristic of grade IV primary glioblastomas, this antibody cannot differentiate primary glioblastoma from reactive gliosis.
20659156 serum 2-hydroxyglutarate concentrations were substantially increased in AML patients with both IDH1 and IDH2 mutations
20659156 Observational study of gene-disease association. (HuGE Navigator)
20651067 when stratified by FLT3/ITD status, an IDH1 mutation was an independent adverse factor for relapse in FLT3/ITD(-) patients (P = .008) and a favorable factor in FLT3/ITD(+) patients (P = .02)
20651067 Clinical trial of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20625116 IDH1m is assoc. with a poor prognosis in acute myeloid leukemia with a higher risk of relapse and shorter survival.
20625116 Observational study of gene-disease association. (HuGE Navigator)
20615753 The incidence of IDH1 mutation is very high in most diffuse gliomas.[review]
20603105 Studies on the cell-lineages of tumors with IDH1/2 mutations may help clarify the role of these mutations in the development of brain tumors.
20603105 Observational study of gene-disease association. (HuGE Navigator)
20567020 IDH1 and IDH2 mutations are recurring genetic changes in acute myeloid leukemia (AML); they constitute a poor prognostic factor in cytogenetically normal-AML with mutated NPM1 without FLT3-internal tandem duplication
20567020 Observational study of gene-disease association. (HuGE Navigator)
20560678 IDH1 R132H mutation is a powerful prognostic marker in glioblastoma.
20560678 Observational study of gene-disease association. (HuGE Navigator)
20538800 IDH1 and IDH2 mutations are common genetic aberrations in AML, and IDH1 mutations may carry prognostic value in distinct subtypes of AML.
20538800 Observational study of gene-disease association. (HuGE Navigator)
20534697 demonstrate the presence of IDH1 R132H mutation in myeloproliferative neoplasms with a lower frequency than that reported in AML
20514489 This study identified IDH1 mutations in 10/24 (42%) cases, which also included a solid tumor portion (type 2 GC), but not in 11 "classical" cases without solid tumor mass (type 1 GC).
20510884 IDH1 and IDH2 mutations are relevant to the progression of gliomas, prognosis and treatment of patients with gliomas harboring the mutation [review]
20508616 IDH1 mutations are associated with chronic-, fibrotic- or blast-phase essential thrombocythemia, polycythemia vera or myelofibrosis.
20508616 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20494930 IDH1 mutations are recurrent molecular aberrations in patients with myelodysplastic syndromes and are an independent prognostic marker
20494930 Observational study of gene-disease association. (HuGE Navigator)
20485375 IDH1 mutations are associated with myelodysplastic syndrome and acute myeloid leukemia.
20473936 report that diffuse astrocytic gliomas can be separated into 2 major molecular groups with distinct genomic and mRNA profiles as well as IDH1 gene mutation status
20465388 O(6)-methylguanine DNA methyltransferase (MGMT) status, and mutations of isocitrate dehydrogenases 1 and 2 (IDH1/IDH2) are currently the three most pertinent markers in diffuse gliomas [Review]
20459648 IDH1 and p53 may have a role in osteosarcoma
20427748 This study identified the IDH1 mutation status of a large series of gliomas analyzed by array-based comparative genomic hybridization (aCGH). We investigated whether the occurrence of IDH1 mutation correlates with 1p19q status.
20427748 Observational study of gene-disease association. (HuGE Navigator)
20410924 IDH1 gene mutation is associated with blast-phase myeloproliferative neoplasms.
20410924 Observational study of gene-disease association. (HuGE Navigator)
20376086 Observational study of gene-disease association. (HuGE Navigator)
20376084 Mutations of IDH1 genes is associated with early and accelerated phases of myelodysplastic syndromes and myeloproliferative neoplasms.
20376084 Observational study of gene-disease association. (HuGE Navigator)
20368543 IDH1 and IDH2 mutations are recurrent in de novo cytogenetically normal acute myeloid leukemia and have an unfavorable impact on outcome.
20368538 IDH1 SNP rs11554137 but not IDH1 R132 mutations are associated with an inferior outcome in cytogenetically normal acute myeloid leukemia.
20368538 Observational study of gene-disease association. (HuGE Navigator)
20367200 Mutations in IDH seem to play an important role in the formation of specific subtypes of gliomas.
20227112 Isocitrate dehydrogenase 1 mutation R132H is associated with myelodysplastic syndrome.
20174854 IDH1 mutations are not associated with high-grade gliomas.
20171178 functionally relevant IDH1 mutations can also occur in thyroid cancer, particularly anaplastic thyroid cancer, suggesting a potential tumorigenic role of the IDH1 system that could represent a new therapeutic target for thyroid cancer.
20171147 Less than half of patients with cytogenetically normal acute myeloid leukemia with elevated 2-hydroxyglutarate possessed IDH1 mutations.
20160062 this homogeneously treated group of anaplastic oligodendroglioma patients, the presence of IDH1 mutations was found to carry a very strong prognostic significance for overall survival
20142433 IDH1 mutation confer an enzymatic gain of function that dramatically increases 2-hydroxyglutarate in acute myelogenous leukemia
20133500 Mutation of IDH1 appears to be a very strong prognostic factor in diffuse gliomas.
20131059 Observational study of gene-disease association. (HuGE Navigator)
20129251 Aberrations and gene expression of EGFR, NF1, and PDGFRA/IDH1 each define the Classical, Mesenchymal, and Proneural subtypes, respectively of glioblastoma multiforme
20127344 The prognostic IDH1( R132 ) mutation is associated with reduced NADP+-dependent IDH activity in glioblastoma.
20097881 Distinct clinical and biologic characteristics in adult acute myeloid leukemia bearing the isocitrate dehydrogenase 1 mutation.
20097881 Observational study of gene-disease association. (HuGE Navigator)
20077503 analysis of non-p.R132H mutations in IDH1 in distinct molecular subtypes of glioma
19935646 data demonstrate that the IDH1 mutations result in production of the onco-metabolite 2HG, and indicate that the excess 2HG which accumulates in vivo contributes to the formation and malignant progression of gliomas
19933982 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19933982 These results indicate that IDH1 mutations identify a subgroup of gliomas with an improved survival, but are unrelated to the temozolomide response.
19915484 testing for IDH1/2 mutations can be effectively performed in a clinical setting and can enhance the accuracy of diagnosis of gliomas
19915015 IDH1 and 2 mutations are very rare in paragangliomas and pheochromocytomas and do not appear to play an important role in oncogenic HIF activation known to be present in these tumors.
19903171 Immunohistochemistry of primary brain tumors demonstrated a strong cytoplasmic and weaker nuclear staining OF IDH1
19805672 in glioblastoma patients managed according to current standards of care. MGMT promoter methylation and IDH1 mutational status allow for stratification into prognostically distinct subgroups.
19765000 IDH1 or IDH2 mutation plays a role in early tumor progression of several types of glioma
19765000 Observational study of gene-disease association. (HuGE Navigator)
19755387 IDH1 mutations are a strong predictor of a more favorable prognosis and a highly selective molecular marker of secondary glioblastomas that complements clinical criteria for distinguishing them from primary glioblastomas.
19755387 Observational study of gene-disease association. (HuGE Navigator)
19667985 Studies indicate that mutations in IDH1/IDH2 are specific for diffuse gliomas.
19657110 Mutation in IDH1 gene was found in acute myeloid leukemia.
19636000 Isocitrate dehydrogenase 1 codon 132 mutation is an important prognostic biomarker in gliomas.
19636000 Observational study of gene-disease association. (HuGE Navigator)
19554337 In patients with glioma, IDH1 mutations of the R132C type are strongly associated with astrocytoma. In addition, patients with anaplastic glioma harboring IDH1 mutations were on average 6 years younger than those without these alterations.
19554337 Observational study of gene-disease association. (HuGE Navigator)
19543740 Pilocytic astrocytomas had BRAF fusions in 70% of cases but not IDH1 or IDH2 mutations. Diffuse astrocytomas had IDH1 mutations in 76% of cases but not IDH2 mutations or BRAF fusions. Analysis of BRAF and IDH1 separates pilocytic from diffuse astrocytoma.
19469031 Observational study of gene-disease association. (HuGE Navigator)
19435942 IDH1 mutations are present in the majority of common adult gliomas but rare in primary glioblastomas.
19411854 Frequent IDH1 mutations in supratentorial primitive neuroectodermal tumors of adults.
19411854 Observational study of gene-disease association. (HuGE Navigator)
19378339 study suggests that despite the infrequent incidence of the IDH1 mutations in prostate cancers and B-ALL, mutated IDH1 could be therapeutically targeted in these cancers and in glial tumors with the IDH1 mutations
19378339 Observational study of gene-disease association. (HuGE Navigator)
19359588 IDH1 appears to function as a tumor suppressor that, when mutationally inactivated, contributes to tumorigenesis in part through induction of the HIF-1 pathway
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19350208 Mutations of IDH1 is not detected in brain metastases of colorectal cancer.
19340432 in families with Li-Fraumeni syndrome, study identified IDH1 mutations in 5 astrocytomas that developed in carriers of a TP53 germline mutation; all were R132C (CGT-->TGT)
19246647 presence of IDH1 mutations in secondary glioblastomas and their near-complete absence in primary glioblastomas reinforce the concept that despite their histological similarities, these subtypes are genetically and clinically distinct entities
19246647 Observational study of gene-disease association. (HuGE Navigator)
19228619 Mutations of NADP(+)-dependent isocitrate dehydrogenases encoded by IDH1 and IDH2 occur in a majority of several types of malignant gliomas.
19117336 These data indicate that cancer mutations affecting IDH1(R132) are tissue-specific, and suggest that it plays a unique role in the development of high-grade gliomas.
18985363 Data show that the very high frequency of IDH1 mutations occurrs in diffuse astrocytomas, oligodendrogliomas, oligoastrocytomas and secondary glioblastomas.
18854154 Knockdown of isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18772396 genomic analysis of glioblastoma multiforme; recurrent mutations in the active site of isocitrate dehydrogenase 1 (IDH1) were found in 12% of the glioblastoma multiforme patients
18187620 Knockdown of isocitrate dehydrogenase 1 (NADP+), soluble (IDH1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
15936593 loss of IDPc and Prx-II during tumor development may involve in tumor progression and metastasis
12923220 IDH1 activity is coordinately regulated with the cholesterol and fatty acid biosynthetic pathways and suggest that it is the source for the cytosolic NADPH required by these pathways

AA Sequence

MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKHNVG      1 - 70
VKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYR     71 - 140
ATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLS    141 - 210
TKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDS    211 - 280
VAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNK    281 - 350
ELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL          351 - 414
//

Text Mined References (489)

PMID Year Title
26951332 2016 Isocitrate dehydrogenase 1 mutations prime the all-trans retinoic acid myeloid differentiation pathway in acute myeloid leukemia.
26945349 2016 Isocitrate Dehydrogenase (IDH)1/2 Mutations as Prognostic Markers in Patients With Glioblastomas.
26936071 2016 Systematic analysis of overall survival and interactions between tumor mutations and drug treatment.
26927556 2016 [The expression of IDH1 (R132H) is positively correlated with cell proliferation and angiogenesis in glioma samples].
26834160 2016 Elevation of Urinary 2-Hydroxyglutarate in IDH-Mutant Glioma.
26700815 2016 Insulator dysfunction and oncogene activation in IDH mutant gliomas.
26678339 2015 Extreme Vulnerability of IDH1 Mutant Cancers to NAD+ Depletion.
26669865 2016 Noninvasive Quantification of 2-Hydroxyglutarate in Human Gliomas with IDH1 and IDH2 Mutations.
26618343 2016 Integrated genomic characterization of IDH1-mutant glioma malignant progression.
26617931 2015 IDH1 R132H mutation in a pilocytic astrocytoma: a case report.
26599207 2015 A Comprehensive Analysis of Common and Rare Variants to Identify Adiposity Loci in Hispanic Americans: The IRAS Family Study (IRASFS).
26582645 2016 Pretreatment d-2-hydroxyglutarate serum levels negatively impact on outcome in IDH1-mutated acute myeloid leukemia.
26562302 2015 Mutational Hotspot of TET2, IDH1, IDH2, SRSF2, SF3B1, KRAS, and NRAS from Human Systemic Mastocytosis Are Not Conserved in Canine Mast Cell Tumors.
26558387 2015 PCR-Based Simple Subgrouping Is Validated for Classification of Gliomas and Defines Negative Prognostic Copy Number Aberrations in IDH Mutant Gliomas.
26545048 2015 Molecular background of oligodendroglioma: 1p/19q, IDH, TERT, CIC and FUBP1.
26524630 2015 Genomic dynamics associated with malignant transformation in IDH1 mutated gliomas.
26503470 2015 IDH mutation and MGMT promoter methylation in glioblastoma: results of a prospective registry.
26486081 2015 IDH1/2 but not DNMT3A mutations are suitable targets for minimal residual disease monitoring in acute myeloid leukemia patients: a study by the Acute Leukemia French Association.
26485760 2015 IDH1 mutation detection by droplet digital PCR in glioma.
26414224 2016 Combined "Infiltrating Astrocytoma/Pleomorphic Xanthoastrocytoma" Harboring IDH1 R132H and BRAF V600E Mutations.
26395639 2016 ATRX loss in adult supratentorial diffuse astrocytomas correlates with p53 over expression and IDH1 mutation and predicts better outcome in p53 accumulated patients.
26351014 2015 Evaluation of IDH1G105 polymorphism as prognostic marker in intermediate-risk AML.
26338964 2015 IDH1/2 mutation status combined with Ki-67 labeling index defines distinct prognostic groups in glioma.
26337623 2015 IDH1 mutation-associated long non-coding RNA expression profile changes in glioma.
26331834 2015 Detection of Dual IDH1 and IDH2 Mutations by Targeted Next-Generation Sequencing in Acute Myeloid Leukemia and Myelodysplastic Syndromes.
26328938 2015 IDH1(R132H) mutation causes a less aggressive phenotype and radiosensitizes human malignant glioma cells independent of the oxygenation status.
26324126 2015 IDH1R¹³²H decreases the proliferation of U87 glioma cells through upregulation of microRNA-128a.
26316565 2015 Patterns of Tumor Contrast Enhancement Predict the Prognosis of Anaplastic Gliomas with IDH1 Mutation.
26314843 2015 TERT promoter mutations contribute to IDH mutations in predicting differential responses to adjuvant therapies in WHO grade II and III diffuse gliomas.
26276726 2015 Combined IDH1 mutation and MGMT methylation status on long-term survival of patients with cerebral low-grade glioma.
26243269 2015 IDH1 mutation is prognostic for diffuse astrocytoma but not low-grade oligodendrogliomas in patients not treated with early radiotherapy.
26228814 2016 IDH1 and IDH2 mutations in myelodysplastic syndromes and role in disease progression.
26189213 2015 Prevalence and Clinical Effect of IDH1 and IDH2 Mutations Among Cytogenetically Normal Acute Myeloid Leukemia Patients.
26185030 2016 Distinctive Genetic Profile With IDH1, TP53, and MLH1 Mutations in a Radiation-Induced Anaplastic Astrocytoma.
26161668 2015 Mutant IDH1 Dysregulates the Differentiation of Mesenchymal Stem Cells in Association with Gene-Specific Histone Modifications to Cartilage- and Bone-Related Genes.
26158269 2015 IDH-Mutation Is a Weak Predictor of Long-Term Survival in Glioblastoma Patients.
26147657 2015 Role of isocitrate dehydrogenase 1/2 (IDH 1/2) gene mutations in human tumors.
26138051 2015 Prognostic impact of molecular phenotype in patients with recurrent anaplastic glioma treated with prolonged administration of temozolomide.
26125858 2015 IDH1 and IDH2 mutations in different histologic subtypes and WHO grading gliomas in a sample from Northern Brazil.
26115961 2016 Analysis of IDH1-R132 mutation, BRAF V600 mutation and KIAA1549-BRAF fusion transcript status in central nervous system tumors supports pediatric tumor classification.
26109200 2015 The chemokine receptor CXCR7 influences prognosis in human glioma in an IDH1-dependent manner.
26095778 2015 Molecular categorisation of gliomas.
26091668 2015 DNA copy number analysis of Grade II-III and Grade IV gliomas reveals differences in molecular ontogeny including chromothripsis associated with IDH mutation status.
26061753 2015 Glioma Groups Based on 1p/19q, IDH, and TERT Promoter Mutations in Tumors.
26049021 2015 IDH1, a CHOP and C/EBP?-responsive gene under ER stress, sensitizes human melanoma cells to hypoxia-induced apoptosis.
26046462 2015 The oncometabolite D-2-hydroxyglutarate induced by mutant IDH1 or -2 blocks osteoblast differentiation in vitro and in vivo.
26045167 2015 IDH1 Mutation Induces Reprogramming of Pyruvate Metabolism.
26022161 2015 Loss of 5-hydroxymethylcytosine and intratumoral heterogeneity as an epigenomic hallmark of glioblastoma.
26016821 2015 Characteristics, clinical outcome, and prognostic significance of IDH mutations in AML.
26008980 2015 Mechanism for enhanced 5-aminolevulinic acid fluorescence in isocitrate dehydrogenase 1 mutant malignant gliomas.
26006098 2015 Evaluation of IDH1 status in diffusely infiltrating gliomas by immunohistochemistry using anti-mutant and wild type IDH1 antibodies.
25987093 2015 Mutation Analysis of IDH1/2 Genes in Unselected De novo Acute Myeloid Leukaemia Patients in India - Identification of A Novel IDH2 Mutation.
25964481 2015 Combined analysis of TERT, EGFR, and IDH status defines distinct prognostic glioblastoma classes.
25962792 2015 IDH mutant diffuse and anaplastic astrocytomas have similar age at presentation and little difference in survival: a grading problem for WHO.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895133 2015 Inhibition of mutant IDH1 decreases D-2-HG levels without affecting tumorigenic properties of chondrosarcoma cell lines.
25862748 2015 Diagnostic value of plasma and urinary 2-hydroxyglutarate to identify patients with isocitrate dehydrogenase-mutated glioma.
25849605 2015 Radiological and pathological features associated with IDH1-R132H mutation status and early mortality in newly diagnosed anaplastic astrocytic tumours.
25836588 2015 Clinical and biological implications of ancestral and non-ancestral IDH1 and IDH2 mutations in myeloid neoplasms.
25818003 2015 Identification of proteins responsible for adriamycin resistance in breast cancer cells using proteomics analysis.
25811801 2015 D-2-Hydroxyglutarate does not mimic all the IDH mutation effects, in particular the reduced etoposide-triggered apoptosis mediated by an alteration in mitochondrial NADH.
25790191 2015 LOX expression and functional analysis in astrocytomas and impact of IDH1 mutation.
25783747 2015 Molecular classification of diffuse cerebral WHO grade II/III gliomas using genome- and transcriptome-wide profiling improves stratification of prognostically distinct patient groups.
25778530 2015 Functions of idh1 and its mutation in the regulation of developmental hematopoiesis in zebrafish.
25732040 2015 Glioblastoma adaptation traced through decline of an IDH1 clonal driver and macro-evolution of a double-minute chromosome.
25706986 2015 Metabolic reprogramming in mutant IDH1 glioma cells.
25701198 2015 IDH mutation status and role of WHO grade and mitotic index in overall survival in grade II-III diffuse gliomas.
25678837 2015 New developments in the pathogenesis and therapeutic targeting of the IDH1 mutation in glioma.
25674227 2014 Surgically treated incidentally discovered low-grade gliomas are mostly IDH mutated and 1p19q co-deleted with favorable prognosis.
25652153 2015 Diagnostic advantage of double immunohistochemistry using two mutation-specific anti-IDH antibodies (HMab-1 and MsMab-1) in gliomas.
25651001 2015 Presence of isocitrate dehydrogenase mutations may predict clinical response to hypomethylating agents in patients with acute myeloid leukemia.
25648147 2015 FOXOs support the metabolic requirements of normal and tumor cells by promoting IDH1 expression.
25634750 2015 Comparison of next-generation sequencing mutation profiling with BRAF and IDH1 mutation-specific immunohistochemistry.
25586680 2015 Mathematical analysis predicts imbalanced IDH1/2 expression associates with 2-HG-inactivating ?-oxygenation pathway in colorectal cancer.
25586175 2015 Overexpression of isocitrate dehydrogenase-1R¹³²H enhances the proliferation of A172 glioma cells via aerobic glycolysis.
25555220 2015 Proximity ligation assay evaluates IDH1R132H presentation in gliomas.
25524848 2015 IDH1/2 mutation is associated with seizure as an initial symptom in low-grade glioma: A report of 311 Chinese adult glioma patients.
25523507 2015 High IDH1 expression is associated with a poor prognosis in cytogenetically normal acute myeloid leukemia.
25511738 2015 Genome-wide transcriptional analyses of Chinese patients reveal cell migration is attenuated in IDH1-mutant glioblastomas.
25496513 2014 Isocitrate dehydrogenase 1 R132C mutation occurs exclusively in microsatellite stable colorectal cancers with the CpG island methylator phenotype.
25486927 2015 Acquired somatic mutations of isocitrate dehydrogenases 1 and 2 (IDH1 and IDH2) in preleukemic disorders.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25455102 2015 IDH1 mutations is prognostic marker for primary glioblastoma multiforme but MGMT hypermethylation is not prognostic for primary glioblastoma multiforme.
25432631 2015 Isocitrate dehydrogenase 1 mutations (IDH1) and p16/CDKN2A copy number change in conventional chondrosarcomas.
25407774 2015 Prognostic Relevance of Histomolecular Classification of Diffuse Adult High-Grade Gliomas with Necrosis.
25391653 2015 Selective inhibition of mutant isocitrate dehydrogenase 1 (IDH1) via disruption of a metal binding network by an allosteric small molecule.
25355558 2014 Genetic variations in IDH gene as prognosis predictors in TACE-treated hepatocellular carcinoma patients.
25283382 2015 Decreasing GSH and increasing ROS in chemosensitivity gliomas with IDH1 mutation.
25277207 2014 Mutations in CIC and IDH1 cooperatively regulate 2-hydroxyglutarate levels and cell clonogenicity.
25251602 2015 Metabolomic comparison between cells over-expressing isocitrate dehydrogenase 1 and 2 mutants and the effects of an inhibitor on the metabolism.
25243911 2014 Glioma cells with the IDH1 mutation modulate metabolic fractional flux through pyruvate carboxylase.
25225364 2014 Hominoid-specific enzyme GLUD2 promotes growth of IDH1R132H glioma.
25170661 2014 Tumor location and IDH1 mutation may predict intraoperative seizures during awake craniotomy.
25164322 2014 Polysialic acid is associated with better prognosis and IDH1-mutation in diffusely infiltrating astrocytomas.
25155243 2014 IDH mutation in glioma: new insights and promises for the future.
25150284 2014 Combined analysis of TERT, EGFR, and IDH status defines distinct prognostic glioblastoma classes.
25135281 2014 The tumor suppressor prostate apoptosis response-4 (Par-4) is regulated by mutant IDH1 and kills glioma stem cells.
25078896 2014 Isocitrate dehydrogenase 1 and 2 mutations in gliomas.
25043045 2014 Mutant IDH inhibits HNF-4? to block hepatocyte differentiation and promote biliary cancer.
25040869 2015 Mutations in IDH1 and IDH2 are not present in sporadic ovarian sex cord-stromal tumours.
25035396 2014 Mutant IDH1-driven cellular transformation increases RAD51-mediated homologous recombination and temozolomide resistance.
25033601 2014 [Comparative characteristics of genetic aberrations in glioblastomas in children and adults].
25029120 2014 Isocitrate dehydrogenase-1 is mutated in inflammatory bowel disease-associated intestinal adenocarcinoma with low-grade tubuloglandular histology but not in sporadic intestinal adenocarcinoma.
25008768 2014 Integrated DNA methylation and copy-number profiling identify three clinically and biologically relevant groups of anaplastic glioma.
25008158 2015 IDH1/2 mutation detection in gliomas.
25005896 2014 IDH1 R132H mutation generates a distinct phospholipid metabolite profile in glioma.
24993250 2014 The impact of concurrent temozolomide with adjuvant radiation and IDH mutation status among patients with anaplastic astrocytoma.
24986863 2014 Cancer-associated isocitrate dehydrogenase 1 (IDH1) R132H mutation and d-2-hydroxyglutarate stimulate glutamine metabolism under hypoxia.
24970694 2015 CXCR7 and CXCR4 Expressions in Infiltrative Astrocytomas and Their Interactions with HIF1? Expression and IDH1 Mutation.
24958096 2015 Malignant clinical features of anaplastic gliomas without IDH mutation.
24936872 2014 Prognostic value of isocitrate dehydrogenase mutations in myelodysplastic syndromes: a retrospective cohort study and meta-analysis.
24922649 2014 Spontaneous in vitro senescence of glioma cells confirmed by an antibody against IDH1R132H.
24903073 2014 IDH1 mutation is associated with seizures and protoplasmic subtype in patients with low-grade gliomas.
24898068 2014 Isocitrate dehydrogenase mutation is frequently observed in giant cell tumor of bone.
24895549 2014 IDH1(R132H) mutation increases U87 glioma cell sensitivity to radiation therapy in hypoxia.
24889502 2014 A new sensitive PCR assay for one-step detection of 12 IDH1/2 mutations in glioma.
24887488 2014 Mutation and expression analysis of the IDH1, IDH2, DNMT3A, and MYD88 genes in colorectal cancer.
24880135 2014 The driver and passenger effects of isocitrate dehydrogenase 1 and 2 mutations in oncogenesis and survival prolongation.
24877111 2014 IDH mutations: genotype-phenotype correlation and prognostic impact.
24868540 2014 IDH1/IDH2 but not TP53 mutations predict prognosis in Bulgarian glioblastoma patients.
24867810 2014 Isocitrate dehydrogenase mutations in chondrosarcoma: the crossroads between cellular metabolism and oncogenesis.
24860178 2014 Predicting the likelihood of an isocitrate dehydrogenase 1 or 2 mutation in diagnoses of infiltrative glioma.
24857351 2014 New IDH1 I113T mutation associated with BRAF V600E mutation: new driver of gliomagenesis?
24847087 2014 Imaging growth and isocitrate dehydrogenase 1 mutation are independent predictors for diffuse low-grade gliomas.
24771584 2014 Mutant IDH1 inhibits PI3K/Akt signaling in human glioma.
24760710 2014 Isocitrate dehydrogenase 1 (IDH1) mutation in breast adenocarcinoma is associated with elevated levels of serum and urine 2-hydroxyglutarate.
24755473 2014 IDH1 mutations alter citric acid cycle metabolism and increase dependence on oxidative mitochondrial metabolism.
24722048 2014 Mutations in IDH1, IDH2, and in the TERT promoter define clinically distinct subgroups of adult malignant gliomas.
24699305 2014 DNMT3A and IDH mutations in acute myeloid leukemia and other myeloid malignancies: associations with prognosis and potential treatment strategies.
24626950 2014 Mutation of isocitrate dehydrogenase 1 induces glioma cell proliferation via nuclear factor-?B activation in a hypoxia-inducible factor 1-? dependent manner.
24606448 2014 Molecular evaluation of DNMT3A and IDH1/2 gene mutation: frequency, distribution pattern and associations with additional molecular markers in normal karyotype Indian acute myeloid leukemia patients.
24590270 2014 Quantitative metabolome analysis profiles activation of glutaminolysis in glioma with IDH1 mutation.
24569570 2014 Mutations of isocitrate dehydrogenase 1 and 2 in intrahepatic cholangiocarcinoma.
24565682 2014 Prognostic value of IDH1 mutations identified with PCR-RFLP assay in acute myeloid leukemia patients.
24557705 2014 Can diffusion tensor imaging noninvasively detect IDH1 gene mutations in astrogliomas? A retrospective study of 112 cases.
24532263 2014 Analysis of KIAA1549-BRAF fusion gene expression and IDH1/IDH2 mutations in low grade pediatric astrocytomas.
24531386 2014 IDH1 p.R132 mutations may not be actively involved in the carcinogenesis of hepatocellular carcinoma.
24529257 2014 D-2-Hydroxyglutarate producing neo-enzymatic activity inversely correlates with frequency of the type of isocitrate dehydrogenase 1 mutations found in glioma.
24511544 2014 Isocitrate dehydrogenase-1 mutations as prognostic biomarker in glioblastoma multiforme patients in West Bohemia.
24510240 2014 The combination of IDH1 mutations and MGMT methylation status predicts survival in glioblastoma better than either IDH1 or MGMT alone.
24478380 2014 Circulating oncometabolite 2-hydroxyglutarate is a potential surrogate biomarker in patients with isocitrate dehydrogenase-mutant intrahepatic cholangiocarcinoma.
24473683 2014 C-terminally truncated form of ?B-crystallin is associated with IDH1 R132H mutation in anaplastic astrocytoma.
24460285 2013 Molecular investigation of isocitrate dehydrogenase gene (IDH) mutations in gliomas: first report of IDH2 mutations in Indian patients.
24443894 2014 IDH1 and IDH2 mutations confer an adverse effect in patients with acute myeloid leukemia lacking the NPM1 mutation.
24405933 2014 Metabolic alterations due to IDH1 mutation in glioma: opening for therapeutic opportunities?
24384677 2014 Characterizing invading glioma cells based on IDH1-R132H and Ki-67 immunofluorescence.
24376688 2013 The Frequency and clinical significance of IDH1 mutations in Chinese acute myeloid leukemia patients.
24368190 2014 Up-regulated isocitrate dehydrogenase 1 suppresses proliferation, migration and invasion in osteosarcoma: in vitro and in vivo.
24362902 2014 An IDH1 mutation inhibits growth of glioma cells via GSH depletion and ROS generation.
24333121 2014 Inhibition of glutaminase selectively suppresses the growth of primary acute myeloid leukemia cells with IDH mutations.
24324372 2013 The significance of IDH1 mutations in tumor-associated seizure in 60 Chinese patients with low-grade gliomas.
24311631 2014 Sequencing IDH1/2 glioma mutation hotspots in gliomas and malignant peripheral nerve sheath tumors.
24305719 2014 IDH1 mutant malignant astrocytomas are more amenable to surgical resection and have a survival benefit associated with maximal surgical resection.
24295421 2013 IDH mutations in tumorigenesis and their potential role as novel therapeutic targets.
24286310 2014 Enhancement of UVB radiation-mediated apoptosis by knockdown of cytosolic NADP+-dependent isocitrate dehydrogenase in HaCaT cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24160898 2013 Prognostic value of isocitrate dehydrogenase 1, O6-methylguanine-DNA methyltransferase promoter methylation, and 1p19q co-deletion in Japanese malignant glioma patients.
24149775 2014 Correlation of IDH1/2 mutation with clinicopathologic factors and prognosis in anaplastic gliomas: a report of 203 patients from China.
24129546 2013 Correlation between the prognostic value and the expression of the stem cell marker CD133 and isocitrate dehydrogenase1 in glioblastomas.
24089051 2014 Cystic glioblastoma: an evaluation of IDH1 status and prognosis.
24077277 2013 An R132H mutation in isocitrate dehydrogenase 1 enhances p21 expression and inhibits phosphorylation of retinoblastoma protein in glioma cells.
24068788 2013 Prognostic or predictive value of MGMT promoter methylation in gliomas depends on IDH1 mutation.
24046070 2013 Isocitrate dehydrogenase 1 is a novel plasma biomarker for the diagnosis of non-small cell lung cancer.
24019001 2013 Non-invasive in vivo assessment of IDH1 mutational status in glioma.
24004584 2013 [Mutation of isocitrate dehydrogenase gene in Chinese patients with glioma].
23999441 2013 Isocitrate dehydrogenase mutations in leukemia.
23996483 2014 Clonal leukemic evolution in myelodysplastic syndromes with TET2 and IDH1/2 mutations.
23988086 2013 Isocitrate dehydrogenase 1 (IDH1) mutation-specific microRNA signature predicts favorable prognosis in glioblastoma patients with IDH1 wild type.
23954893 2013 Mutant IDH1 promotes leukemogenesis in vivo and can be specifically targeted in human AML.
23934769 2014 An analysis of the prognostic value of IDH1 (isocitrate dehydrogenase 1) mutation in Polish glioma patients.
23934175 2013 cMYC expression in infiltrating gliomas: associations with IDH1 mutations, clinicopathologic features and outcome.
23918605 2013 Long-term survival in primary glioblastoma with versus without isocitrate dehydrogenase mutations.
23904262 2013 IDH1 mutation is associated with improved overall survival in patients with glioblastoma: a meta-analysis.
23894344 2013 IDH1/IDH2 mutations define the prognosis and molecular profiles of patients with gliomas: a meta-analysis.
23877318 2013 IDH1/2 mutations target a key hallmark of cancer by deregulating cellular metabolism in glioma.
23840696 2013 Mutation analysis of IDH1 in paired gliomas revealed IDH1 mutation was not associated with malignant progression but predicted longer survival.
23817809 2013 A population-based study of low-grade gliomas and mutated isocitrate dehydrogenase 1 (IDH1).
23801081 2013 Isocitrate dehydrogenase 1 mutant R132H sensitizes glioma cells to BCNU-induced oxidative stress and cell death.
23793099 2013 BCAT1 promotes cell proliferation through amino acid catabolism in gliomas carrying wild-type IDH1.
23737489 2013 Re-evaluation of nondiagnostic biopsies of suspected low-grade glioma using isocitrate dehydrogenase 1 mutation immunohistochemistry.
23731180 2013 Mutant IDH1 enhances the production of 2-hydroxyglutarate due to its kinetic mechanism.
23689617 2013 Codeletion of 1p and 19q determines distinct gene methylation and expression profiles in IDH-mutated oligodendroglial tumors.
23681562 2013 Combining two biomarkers, IDH1/2 mutations and 1p/19q codeletion, to stratify anaplastic oligodendroglioma in three groups: a single-center experience.
23641016 2013 Serum 2-hydroxyglutarate levels predict isocitrate dehydrogenase mutations and clinical outcome in acute myeloid leukemia.
23598960 2013 Molecular distinction of chondrosarcoma from chondroblastic osteosarcoma through IDH1/2 mutations.
23581583 2013 Isocitrate dehydrogenase 1: what it means to the neurosurgeon: a review.
23561624 2013 IDH1 mutation analysis in low cellularity specimen: a limitation of diagnostic accuracy and a proposal for the diagnostic procedure.
23558169 2013 An inhibitor of mutant IDH1 delays growth and promotes differentiation of glioma cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532369 2013 IDH1 and IDH2 mutations in gliomas.
23512379 2013 What do we know about IDH1/2 mutations so far, and how do we use it?
23504258 2013 Prognostic significance of IDH mutation in adult low-grade gliomas: a meta-analysis.
23494873 2013 Differential molecular genetic analysis in glioblastoma multiforme of long- and short-term survivors: a clinical study in Chinese patients.
23494632 2013 Secondary glioblastomas with IDH1/2 mutations have longer glioma history from preceding lower-grade gliomas.
23486690 2013 Comparative study of IDH1 mutations in gliomas by immunohistochemistry and DNA sequencing.
23486687 2013 1p/19q codeletion and IDH1/2 mutation identified a subtype of anaplastic oligoastrocytomas with prognosis as favorable as anaplastic oligodendrogliomas.
23485734 2013 R132C IDH1 mutations are found in spindle cell hemangiomas and not in other vascular tumors or malformations.
23451940 2013 IDH mutation analysis in gliomas as a diagnostic and prognostic biomarker.
23451042 2013 IDH1-associated primary glioblastoma in young adults displays differential patterns of tumour and vascular morphology.
23438035 2013 PDGFRA amplification is common in pediatric and adult high-grade astrocytomas and identifies a poor prognostic group in IDH1 mutant glioblastoma.
23429602 2013 Significance of complete 1p/19q co-deletion, IDH1 mutation and MGMT promoter methylation in gliomas: use with caution.
23412777 2013 Glioblastoma with oligodendroglial component represents a subgroup of glioblastoma with high prevalence of IDH1 mutation and association with younger age.
23410661 2013 Accumulation of 2-hydroxyglutarate is not a biomarker for malignant progression in IDH-mutated low-grade gliomas.
23391413 2013 Molecular profiling of cholangiocarcinoma shows potential for targeted therapy treatment decisions.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23373447 2013 From genomics to the clinic: biological and translational insights of mutant IDH1/2 in glioma.
23365461 2013 Cooperating gene mutations in childhood acute myeloid leukemia with special reference on mutations of ASXL1, TET2, IDH1, IDH2, and DNMT3A.
23361564 2013 Inherited variant on chromosome 11q23 increases susceptibility to IDH-mutated but not IDH-normal gliomas regardless of grade or histology.
23358936 2013 Interlaboratory comparison of IDH mutation detection.
23330999 2013 Distinct IDH1/IDH2 mutation profiles in purely insular versus paralimbic WHO Grade II gliomas.
23307057 2013 Expanding the spectrum of IDH1 mutations in gliomas.
23264629 2013 The potential for isocitrate dehydrogenase mutations to produce 2-hydroxyglutarate depends on allele specificity and subcellular compartmentalization.
23236540 2013 A population-based study of high-grade gliomas and mutated isocitrate dehydrogenase 1.
23235339 2014 Immunohistochemical demonstration of isocitrate dehydrogenase 1 (IDH1) mutation in a small subset of prostatic carcinomas.
23232569 2013 Mutations in the isocitrate dehydrogenase genes IDH1 and IDH2 in tumors.
23223340 2013 Outcome and molecular characteristics of adolescent and young adult patients with newly diagnosed primary glioblastoma: a study of the Society of Austrian Neurooncology (SANO).
23204232 2013 Disruption of wild-type IDH1 suppresses D-2-hydroxyglutarate production in IDH1-mutated gliomas.
23192014 2013 IDH1 and IDH2 mutations in therapy-related myelodysplastic syndrome and acute myeloid leukemia are associated with a normal karyotype and with der(1;7)(q10;p10).
23187294 2013 GADD45A methylation predicts poor overall survival in acute myeloid leukemia and is associated with IDH1/2 and DNMT3A mutations.
23184331 2013 Prognostic impact of the isocitrate dehydrogenase 1 single-nucleotide polymorphism rs11554137 in malignant gliomas.
23135354 2013 Mutations of the epigenetics-modifying gene (DNMT3a, TET2, IDH1/2) at diagnosis may induce FLT3-ITD at relapse in de novo acute myeloid leukemia.
23115158 2013 Overexpression of isocitrate dehydrogenase mutant proteins renders glioma cells more sensitive to radiation.
23111198 2012 Pyrosequencing of IDH1 and IDH2 mutations in brain tumors and non-neoplastic conditions.
23079654 2012 Hotspot mutations in H3F3A and IDH1 define distinct epigenetic and biological subgroups of glioblastoma.
23074281 2012 Prospective serial evaluation of 2-hydroxyglutarate, during treatment of newly diagnosed acute myeloid leukemia, to assess disease activity and therapeutic response.
23072665 2013 IDH1 mutations in oligodendroglial tumors: comparative analysis of direct sequencing, pyrosequencing, immunohistochemistry, nested PCR and PNA-mediated clamping PCR.
23071358 2012 IDH1 and IDH2 mutations in tumorigenesis: mechanistic insights and clinical perspectives.
23064941 2013 Usefulness of immunohistochemical expression analysis of metabolic-related molecules in differentiating between intracranial neoplastic and non-neoplastic lesions.
23063752 2013 Identification of Hedgehog pathway responsive glioblastomas by isocitrate dehydrogenase mutation.
23053494 2013 Progressive adult primary glioblastoma in the medulla oblongata with an unmethylated MGMT promoter and without an IDH mutation.
23041832 2013 Diagnostic implications of IDH1-R132H and OLIG2 expression patterns in rare and challenging glioblastoma variants.
23039322 2013 Type and location of isocitrate dehydrogenase mutations influence clinical characteristics and disease outcome of acute myeloid leukemia.
23038259 2012 Isocitrate dehydrogenase (IDH) mutations promote a reversible ZEB1/microRNA (miR)-200-dependent epithelial-mesenchymal transition (EMT).
23035067 2012 Detection of IDH1 mutation in the plasma of patients with glioma.
23015095 2012 The prognostic value of IDH mutations and MGMT promoter status in secondary high-grade gliomas.
23011765 2013 Expression of R132H mutational IDH1 in human U87 glioblastoma cells affects the SREBP1a pathway and induces cellular proliferation.
22968464 2012 SRSF2 mutations in primary myelofibrosis: significant clustering with IDH mutations and independent association with inferior overall and leukemia-free survival.
22945896 2012 MR imaging findings of extraventricular neurocytoma: a series of ten patients confirmed by immunohistochemistry of IDH1 gene mutation.
22929312 2012 Rapid screening of ASXL1, IDH1, IDH2, and c-CBL mutations in de novo acute myeloid leukemia by high-resolution melting.
22922872 2012 A low-frequency variant at 8q24.21 is strongly associated with risk of oligodendroglial tumors and astrocytomas with IDH1 or IDH2 mutation.
22922798 2012 IDH1 mutation of gliomas with long-term survival analysis.
22917530 2012 IDH mutations in acute myeloid leukemia.
22904127 2012 IDH1 mutations in diffusely infiltrating astrocytomas: grade specificity, association with protein expression, and clinical relevance.
22899282 2012 A heterozygous IDH1R132H/WT mutation induces genome-wide alterations in DNA methylation.
22890969 2012 Molecular genetics of adult grade II gliomas: towards a comprehensive tumor classification system.
22885298 2012 Mutant IDH1 is required for IDH1 mutated tumor cell growth.
22869205 2012 Frequent ATRX, CIC, FUBP1 and IDH1 mutations refine the classification of malignant gliomas.
22868530 2012 Papillary glioneuronal tumor--a rare entity: report of four cases and brief review of literature.
22844452 2012 Clonal analysis in recurrent astrocytic, oligoastrocytic and oligodendroglial tumors implicates IDH1- mutation as common tumor initiating event.
22825915 2012 IDH1/2 mutation is a prognostic marker for survival and predicts response to chemotherapy for grade II gliomas concomitantly treated with radiation therapy.
22824796 2013 Mutations in isocitrate dehydrogenase 1 and 2 occur frequently in intrahepatic cholangiocarcinomas and share hypermethylation targets with glioblastomas.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22809434 2012 Mutation analysis of isocitrate dehydrogenase in acute lymphoblastic leukemia.
22790483 2012 Histopathological malignant progression of grade II and III gliomas correlated with IDH1/2 mutation status.
22785212 2012 Isocitrate dehydrogenase 1R132H mutation in microglia/macrophages in gliomas: indication of a significant role of microglia/macrophages in glial tumorigenesis.
22781800 2012 [Analysis of IDH1 and IDH2 mutations in patients with acute myeloid leukemia].
22781348 2012 [Feature analysis of IDH1 mutation in oligodendroglial tumors].
22772980 2012 Low rate of R132H IDH1 mutation in infratentorial and spinal cord grade II and III diffuse gliomas.
22772731 2012 IDH1 mutations inhibit multiple ?-ketoglutarate-dependent dioxygenase activities in astroglioma.
22763442 2012 IDH1(R132H) mutation increases murine haematopoietic progenitors and alters epigenetics.
22752663 2013 IDH1 mutation as a potential novel biomarker for distinguishing pseudoprogression from true progression in patients with glioblastoma treated with temozolomide and radiotherapy.
22748659 2012 IDH mutations in human glioma.
22688054 2012 Nuclear exclusion of TET1 is associated with loss of 5-hydroxymethylcytosine in IDH1 wild-type gliomas.
22687971 2012 [IDH1/2 gene mutations in myelodysplastic syndromes].
22683334 2012 IDH1 and IDH2 have critical roles in 2-hydroxyglutarate production in D-2-hydroxyglutarate dehydrogenase depleted cells.
22668828 2013 Glioblastoma cancer stem cells--from concept to clinical application.
22616558 2012 Potential application of IDH1 and IDH2 mutations as prognostic indicators in non-promyelocytic acute myeloid leukemia: a meta-analysis.
22528790 2012 No prognostic value of IDH1 mutations in a series of 100 WHO grade II astrocytomas.
22520341 2012 Adverse impact of IDH1 and IDH2 mutations in primary AML: experience of the Spanish CETLAM group.
22503487 2012 Isocitrate dehydrogenase 1 and 2 mutations in cholangiocarcinoma.
22445362 2012 Isocitrate dehydrogenase 1 R132H mutation is not detected in angiocentric glioma.
22432788 2012 IDH1 mutation in pediatric gliomas: has it a diagnostic and prognostic value?
22427879 2012 Co-deletion of chromosome 1p/19q and IDH1/2 mutation in glioma subsets of brain tumors in Chinese patients.
22415316 2012 IDH mutation and neuroglial developmental features define clinically distinct subclasses of lower grade diffuse astrocytic glioma.
22410704 2012 IDH mutations as an early and consistent marker in low-grade astrocytomas WHO grade II and their consecutive secondary high-grade gliomas.
22399191 2012 Molecular pathogenesis of IDH mutations in gliomas.
22397365 2012 Molecular alterations of isocitrate dehydrogenase 1 and 2 (IDH1 and IDH2) metabolic genes and additional genetic mutations in newly diagnosed acute myeloid leukemia patients.
22396073 2012 Hypoxia-inducible factor-1-regulated protein expression and oligodendroglioma patient outcome: comparison with established biomarkers and preoperative UCSF low-grade scoring system.
22396072 2012 Immunohistochemical detection of IDH1 mutation, p53, and internexin as prognostic factors of glial tumors.
22392125 2012 1P19Q loss but not IDH1 mutations influences WHO grade II gliomas spontaneous growth.
22385606 2012 Isocitrate dehydrogenase mutation hot spots in acute lymphoblastic leukemia and oral cancer.
22360810 2012 Reverse TCA cycle flux through isocitrate dehydrogenases 1 and 2 is required for lipogenesis in hypoxic melanoma cells.
22360629 2012 IDH mutation detection in formalin-fixed paraffin-embedded gliomas using multiplex PCR and single-base extension.
22343901 2012 IDH mutation impairs histone demethylation and results in a block to cell differentiation.
22343889 2012 IDH1 mutation is sufficient to establish the glioma hypermethylator phenotype.
22326863 2012 Glioblastoma with an oligodendroglioma component: distinct clinical behavior, genetic alterations, and outcome.
22323113 2012 Frequent IDH1/2 mutations in intracranial chondrosarcoma: a possible diagnostic clue for its differentiation from chordoma.
22322613 2012 Relationship between tumor enhancement, edema, IDH1 mutational status, MGMT promoter methylation, and survival in glioblastoma.
22291938 2012 Correlation of IDH1 mutation with clinicopathologic factors and prognosis in primary glioblastoma: a report of 118 patients from China.
22281465 2012 [Analyses of IDH1 mutation and MGMT promoter methylation status for 5 cases of long-term survivors with glioblastoma].
22270848 2012 Clinicopathologic and genomic features of gliosarcomas.
22264756 2012 Expression of cytosolic NADP(+)-dependent isocitrate dehydrogenase in melanocytes and its role as an antioxidant.
22238333 2012 Magnetic resonance of 2-hydroxyglutarate in IDH1-mutated low-grade gliomas.
22238332 2012 Detection of 2-hydroxyglutarate in IDH-mutated glioma patients by in vivo spectral-editing and 2D correlation magnetic resonance spectroscopy.
22217666 2012 IDH1/2 mutations in WHO grade II astrocytomas associated with localization and seizure as the initial symptom.
22199315 2011 Correlation between IDH1 gene mutation status and survival of patients treated for recurrent glioma.
22197544 2012 Absence of IDH1-R132H mutation predicts rapid progression of nonenhancing diffuse glioma in older adults.
22192702 Dysembryoplastic neuroepithelial tumor-like neoplasm of the septum pellucidum: review of 2 cases with chromosome 1p/19q and IDH1 analysis.
22180306 2012 Frequent mutation of isocitrate dehydrogenase (IDH)1 and IDH2 in cholangiocarcinoma identified through broad-based tumor genotyping.
22172803 2012 Detection of IDH1 R132H mutation in acute myeloid leukemia by mutation-specific immunohistochemistry.
22166653 2010 Analysis of isocitrate dehydrogenase-1/2 gene mutations in gliomas.
22147457 2011 [IDH1/2 mutations in gliomas].
22144470 2012 Monoallelic expression determines oncogenic progression and outcome in benign and malignant brain tumors.
22136423 2012 Significance of IDH mutations varies with tumor histology, grade, and genetics in Japanese glioma patients.
22113362 2012 Analysis of isocitrate dehydrogenase 1 mutation in 97 patients with glioma.
22106302 2011 Hypoxia promotes isocitrate dehydrogenase-dependent carboxylation of ?-ketoglutarate to citrate to support cell growth and viability.
22101433 2011 Reductive glutamine metabolism by IDH1 mediates lipogenesis under hypoxia.
22076165 2011 Glioblastoma with PNET-like components has a higher frequency of isocitrate dehydrogenase 1 (IDH1) mutation and likely a better prognosis than primary glioblastoma.
22074484 2012 IDH1 mutations are not found in cartilaginous tumours other than central and periosteal chondrosarcomas and enchondromas.
22072542 2012 Concurrent CIC mutations, IDH mutations, and 1p/19q loss distinguish oligodendrogliomas from other cancers.
22064513 2012 Identification of isocitrate dehydrogenase 1 as a potential diagnostic and prognostic biomarker for non-small cell lung cancer by proteomic analysis.
22057236 2011 Ollier disease and Maffucci syndrome are caused by somatic mosaic mutations of IDH1 and IDH2.
22057234 2011 Somatic mosaic IDH1 and IDH2 mutations are associated with enchondroma and spindle cell hemangioma in Ollier disease and Maffucci syndrome.
22052461 2011 5-Hydroxymethylcytosine is strongly depleted in human cancers but its levels do not correlate with IDH1 mutations.
22034964 2012 IDH mutations predict longer survival and response to temozolomide in secondary glioblastoma.
22033490 2012 Differential prognostic effect of IDH1 versus IDH2 mutations in myelodysplastic syndromes: a Mayo Clinic study of 277 patients.
22025298 2011 Whole-exome sequencing detects somatic mutations of IDH1 in metaphyseal chondromatosis with D-2-hydroxyglutaric aciduria (MC-HGA).
22020636 2012 Prognostic significance of alterations in IDH enzyme isoforms in patients with AML treated with high-dose cytarabine and idarubicin.
22015945 2012 Non-invasive detection of 2-hydroxyglutarate and other metabolites in IDH1 mutant glioma patients using magnetic resonance spectroscopy.
22002076 2011 Isocitrate dehydrogenase mutations in gliomas: mechanisms, biomarkers and therapeutic target.
21997850 2012 IDH1 and IDH2 mutation analysis in Chinese patients with acute myeloid leukemia and myelodysplastic syndrome.
21996744 2012 Identification of additional IDH mutations associated with oncometabolite R(-)-2-hydroxyglutarate production.
21983902 2011 Confirmation of R132H mutation of isocitrate dehydrogenase 1 as an independent prognostic factor in anaplastic astrocytoma.
21955925 IDH testing in diagnostic neuropathology: review and practical guideline article invited by the Euro-CNS research committee.
21929658 2012 Mutated IDH1 is a favorable prognostic factor for type 2 gliomatosis cerebri.
21922591 2012 The hypermethylation of the O6-methylguanine-DNA methyltransferase gene promoter in gliomas--correlation with array comparative genome hybridization results and IDH1 mutation.
21912393 2012 IDH mutations in primary myelofibrosis predict leukemic transformation and shortened survival: clinical evidence for leukemogenic collaboration with JAK2V617F.
21910919 2011 Prognostic significance of IDH-1 and MGMT in patients with glioblastoma: one step forward, and one step back?
21904853 2012 TET2, ASXL1, IDH1, IDH2, and c-CBL genes in JAK2- and MPL-negative myeloproliferative neoplasms.
21898821 2011 Proteomic analysis of oligodendrogliomas expressing a mutant isocitrate dehydrogenase-1.
21885076 2011 Metabolism of glioma and IDH1/IDH2 mutations.
21874255 2011 IDH mutations occur frequently in Chinese glioma patients and predict longer survival but not response to concomitant chemoradiotherapy in anaplastic gliomas.
21873548 2011 Prognostic implications of the IDH1 synonymous SNP rs11554137 in pediatric and adult AML: a report from the Children's Oncology Group and SWOG.
21867611 2011 [Isocitrate dehydrogenase gene mutations in acute myeloid leukemia].
21845536 2011 Expression of mutated isocitrate dehydrogenase-1 in gliomas is associated with p53 and EGFR expression.
21784755 2011 Production of 2-hydroxyglutarate by isocitrate dehydrogenase 1-mutated gliomas: an evolutionary alternative to the Warburg shift?
21781445 Detection of IDH1 mutations and the status of MGMT promoter on intraoperative fresh tissue section from frameless neuronavigation needle biopsy. Analysis on 17 patients with brain glial tumor ineligible for craniotomy and tumor resection.
21755347 2011 High frequency of IDH-1 mutation links glioneuronal tumors with neuropil-like islands to diffuse astrocytomas.
21717448 2012 IDH1 mutations in grade II astrocytomas are associated with unfavorable progression-free survival and prolonged postrecurrence survival.
21707716 2011 Immunohistochemical analysis of 1844 human epithelial and haematopoietic tumours and sarcomas for IDH1R132H mutation.
21690245 2011 TET2 promoter methylation in low-grade diffuse gliomas lacking IDH1/2 mutations.
21647154 2011 IDH1 and IDH2 mutations in pediatric acute leukemia.
21647152 2011 Prevalence and prognostic value of IDH1 and IDH2 mutations in childhood AML: a study of the AML-BFM and DCOG study groups.
21643985 2011 IDH mutation status impact on in vivo hypoxia biomarkers expression: new insights from a clinical, nuclear imaging and immunohistochemical study in 33 glioma patients.
21643842 2011 IDH1 and IDH2 mutations, immunohistochemistry and associations in a series of brain tumors.
21625441 2011 Screen for IDH1, IDH2, IDH3, D2HGDH and L2HGDH mutations in glioblastoma.
21598255 2011 IDH1 and IDH2 mutations are frequent events in central chondrosarcoma and central and periosteal chondromas but not in other mesenchymal tumours.
21575384 2011 [Expression of isocitrate dehydrogenase 1 gene R132H and its diagnostic application in glioma].
21569770 2011 IDH1 mutations in gliomas: first series from a tertiary care centre in India with comprehensive review of literature.
21539821 2011 Rapid and reliable detection of IDH1 R132 mutations in acute myeloid leukemia using high-resolution melting curve analysis.
21516462 2011 Prognostic stratification of gliomatosis cerebri by IDH1 R132H and INA expression.
21506885 2011 Protective role of cytosolic NADP(+)-dependent isocitrate dehydrogenase, IDH1, in ischemic pre-conditioned kidney in mice.
21481010 2012 IDH1 mutation, a genetic alteration associated with adult gliomatosis cerebri.
21480859 2011 High incidence of IDH mutations in acute myeloid leukaemia with cuplike nuclei.
21437454 2011 IDH1 mutations in a Brazilian series of Glioblastoma.
21383741 2011 Metabolism unhinged: IDH mutations in cancer.
21356389 2011 Mutant IDH1 confers an in vivo growth in a melanoma cell line with BRAF mutation.
21346257 2011 CBL, CBLB, TET2, ASXL1, and IDH1/2 mutations and additional chromosomal aberrations constitute molecular events in chronic myelogenous leukemia.
21343879 2011 A sensitive and specific diagnostic panel to distinguish diffuse astrocytoma from astrocytosis: chromosome 7 gain with mutant isocitrate dehydrogenase 1 and p53.
21326614 2011 2-hydroxyglutarate production, but not dominant negative function, is conferred by glioma-derived NADP-dependent isocitrate dehydrogenase mutations.
21326241 2011 Glioma cells showing IDH1 mutation cannot be propagated in standard cell culture conditions.
21316759 2011 Some novel features of IDH1-mutated acute myeloid leukemia revealed in Chinese patients.
21314850 2011 Isocitrate dehydrogenase 1 analysis differentiates gangliogliomas from infiltrative gliomas.
21307773 2011 Genetics of the myeloproliferative neoplasms.
21301070 2011 The role of IDH1 mutated tumour cells in secondary glioblastomas: an evolutionary game theoretical view.
21294161 2011 Isocitrate dehydrogenase mutations: a challenge to traditional views on the genesis and malignant progression of gliomas.
21289278 2011 Profiling the effects of isocitrate dehydrogenase 1 and 2 mutations on the cellular metabolome.
21284999 2011 Isocitrate dehydrogenase mutations may be a protective mechanism in glioma patients.
21269460 2011 Initial characterization of the human central proteome.
21233841 2011 IDH1 and IDH2 mutations are rare in pediatric myeloid malignancies.
21225914 2011 Isocitrate dehydrogenase 1/2 mutational analyses and 2-hydroxyglutarate measurements in Wilms tumors.
21181477 2011 R132H-mutation of isocitrate dehydrogenase-1 is not sufficient for HIF-1? upregulation in adult glioma.
21177338 2011 First-line temozolomide chemotherapy in progressive low-grade astrocytomas after radiotherapy: molecular characteristics in relation to response.
21173122 2011 Acute myeloid leukemia with IDH1 or IDH2 mutation: frequency and clinicopathologic features.
21163902 2011 DNA methylation, isocitrate dehydrogenase mutation, and survival in glioma.
21130701 2010 Leukemic IDH1 and IDH2 mutations result in a hypermethylation phenotype, disrupt TET2 function, and impair hematopoietic differentiation.
21088844 2010 Patients with IDH1 wild type anaplastic astrocytomas exhibit worse prognosis than IDH1-mutated glioblastomas, and IDH1 mutation status accounts for the unfavorable prognostic effect of higher age: implications for classification of gliomas.
21083371 2010 Genetic associations of variants in genes encoding HIV-dependency factors required for HIV-1 infection.
21080178 2010 Absence of IDH mutation identifies a novel radiologic and molecular subtype of WHO grade II gliomas with dismal prognosis.
21079649 2010 IDH1 mutant structures reveal a mechanism of dominant inhibition.
21079611 2011 The prognostic impact and stability of Isocitrate dehydrogenase 2 mutation in adult patients with acute myeloid leukemia.
21075857 2010 Molecular classification of low-grade diffuse gliomas.
21069360 2011 Mutation-specific IDH1 antibody differentiates oligodendrogliomas and oligoastrocytomas from other brain tumors with oligodendroglioma-like morphology.
21045145 2010 Inhibition of glutaminase preferentially slows growth of glioma cells with mutant IDH1.
20975740 2010 Molecular mechanisms of "off-on switch" of activities of human IDH1 by tumor-associated mutation R132H.
20975057 2010 IDH1 or IDH2 mutations predict longer survival and response to temozolomide in low-grade gliomas.
20972461 2010 Cancer-associated IDH mutations: biomarker and therapeutic opportunities.
20962861 2011 A nonsense mutation of IDH1 in myelodysplastic syndromes and related disorders.
20946881 2010 IDH1 and IDH2 mutations are frequent in Chinese patients with acute myeloid leukemia but rare in other types of hematological disorders.
20944672 2011 Low prevalence of IDH1 gene mutation in childhood AML in Italy.
20880116 2010 ASXL1 mutation is associated with poor prognosis and acute transformation in chronic myelomonocytic leukaemia.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20874727 2011 Glioma IDH1 mutation patterns off the beaten track.
20805365 2010 IDH1 mutations are detected in 6.6% of 1414 AML patients and are associated with intermediate risk karyotype and unfavorable prognosis in adults younger than 60 years and unmutated NPM1 status.
20725730 2011 IDH1 mutations are common in malignant gliomas arising in adolescents: a report from the Children's Oncology Group.
20702649 2010 Identification of several novel non-p.R132 IDH1 variants in thyroid carcinomas.
20692206 2010 IDH mutations in glioma and acute myeloid leukemia.
20678218 2010 Combined mutations of ASXL1, CBL, FLT3, IDH1, IDH2, JAK2, KRAS, NPM1, NRAS, RUNX1, TET2 and WT1 genes in myelodysplastic syndromes and acute myeloid leukemias.
20667415 2010 Mutational analysis of IDH1 codon 132 in non-Hodgkin lymphomas.
20661018 2010 Application of mutant IDH1 antibody to differentiate diffuse glioma from nonneoplastic central nervous system lesions and therapy-induced changes.
20659156 2010 Increased levels of 2-hydroxyglutarate in AML patients with IDH1-R132H and IDH2-R140Q mutations.
20651067 2010 The prognostic significance of IDH1 mutations in younger adult patients with acute myeloid leukemia is dependent on FLT3/ITD status.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20625116 2010 Prognostic impact of isocitrate dehydrogenase enzyme isoforms 1 and 2 mutations in acute myeloid leukemia: a study by the Acute Leukemia French Association group.
20615753 2011 Isocitrate dehydrogenase-1 mutations: a fundamentally new understanding of diffuse glioma?
20603105 2010 IDH1(R132) mutation identified in one human melanoma metastasis, but not correlated with metastases to the brain.
20567020 2010 IDH1 and IDH2 mutations are frequent genetic alterations in acute myeloid leukemia and confer adverse prognosis in cytogenetically normal acute myeloid leukemia with NPM1 mutation without FLT3 internal tandem duplication.
20560678 2010 Prognostic value of IDH1 mutations identified with PCR-RFLP assay in glioblastoma patients.
20538800 2010 Acquired mutations in the genes encoding IDH1 and IDH2 both are recurrent aberrations in acute myeloid leukemia: prevalence and prognostic value.
20534697 2010 IDH1 R132H mutation is a rare event in myeloproliferative neoplasms as determined by a mutation specific antibody.
20514489 2010 Detection of IDH1 mutations in gliomatosis cerebri, but only in tumors with additional solid component: evidence for molecular subtypes.
20510884 2010 Glioma-derived mutations in IDH: from mechanism to potential therapy.
20508616 2010 IDH1 and IDH2 mutation studies in 1473 patients with chronic-, fibrotic- or blast-phase essential thrombocythemia, polycythemia vera or myelofibrosis.
20494930 2010 IDH1 mutations in patients with myelodysplastic syndromes are associated with an unfavorable prognosis.
20485375 2010 Recurrent IDH mutations in high-risk myelodysplastic syndrome or acute myeloid leukemia with isolated del(5q).
20473936 2011 Molecular signatures classify astrocytic gliomas by IDH1 mutation status.
20465388 2010 Prognostic markers in gliomas.
20459648 2010 The expression and significance of IDH1 and p53 in osteosarcoma.
20427748 2010 All the 1p19q codeleted gliomas are mutated on IDH1 or IDH2.
20410924 2010 IDH1 and IDH2 mutation analysis in chronic- and blast-phase myeloproliferative neoplasms.
20376086 2010 Molecular alterations of the IDH1 gene in AML: a Children's Oncology Group and Southwest Oncology Group study.
20376084 2010 Mutations of IDH1 and IDH2 genes in early and accelerated phases of myelodysplastic syndromes and MDS/myeloproliferative neoplasms.
20368543 2010 IDH1 and IDH2 gene mutations identify novel molecular subsets within de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.
20368538 2010 Impact of IDH1 R132 mutations and an IDH1 single nucleotide polymorphism in cytogenetically normal acute myeloid leukemia: SNP rs11554137 is an adverse prognostic factor.
20367200 2010 2-hydroxyglutarate accumulation caused by IDH mutation is involved in the formation of malignant gliomas.
20227112 2010 Detection of isocitrate dehydrogenase 1 mutation R132H in myelodysplastic syndrome by mutation-specific antibody and direct sequencing.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
20174854 2010 Prognostic significance of histological grading, p53 status, YKL-40 expression, and IDH1 mutations in pediatric high-grade gliomas.
20171178 2010 Identification and functional characterization of isocitrate dehydrogenase 1 (IDH1) mutations in thyroid cancer.
20171147 2010 The common feature of leukemia-associated IDH1 and IDH2 mutations is a neomorphic enzyme activity converting alpha-ketoglutarate to 2-hydroxyglutarate.
20160062 2010 IDH1 and IDH2 mutations are prognostic but not predictive for outcome in anaplastic oligodendroglial tumors: a report of the European Organization for Research and Treatment of Cancer Brain Tumor Group.
20142433 2010 Cancer-associated metabolite 2-hydroxyglutarate accumulates in acute myelogenous leukemia with isocitrate dehydrogenase 1 and 2 mutations.
20133500 2010 IDH1 gene mutations: a new paradigm in glioma prognosis and therapy?
20131059 2010 Rapid and sensitive assessment of the IDH1 and IDH2 mutation status in cerebral gliomas based on DNA pyrosequencing.
20129251 2010 Integrated genomic analysis identifies clinically relevant subtypes of glioblastoma characterized by abnormalities in PDGFRA, IDH1, EGFR, and NF1.
20127344 2010 The prognostic IDH1( R132 ) mutation is associated with reduced NADP+-dependent IDH activity in glioblastoma.
20097881 2010 Distinct clinical and biologic characteristics in adult acute myeloid leukemia bearing the isocitrate dehydrogenase 1 mutation.
20077503 2010 Segregation of non-p.R132H mutations in IDH1 in distinct molecular subtypes of glioma.
19935646 2009 Cancer-associated IDH1 mutations produce 2-hydroxyglutarate.
19933982 2009 IDH1 mutations in low-grade astrocytomas predict survival but not response to temozolomide.
19915484 2009 Diagnostic use of IDH1/2 mutation analysis in routine clinical testing of formalin-fixed, paraffin-embedded glioma tissues.
19915015 2010 Isocitrate dehydrogenase mutations are rare in pheochromocytomas and paragangliomas.
19903171 2010 Characterization of R132H mutation-specific IDH1 antibody binding in brain tumors.
19805672 2009 Molecular predictors of progression-free and overall survival in patients with newly diagnosed glioblastoma: a prospective translational study of the German Glioma Network.
19765000 2009 Analysis of IDH1 and IDH2 mutations in Japanese glioma patients.
19755387 2009 IDH1 mutations as molecular signature and predictive factor of secondary glioblastomas.
19667985 2009 Diagnostic and prognostic markers in gliomas.
19657110 2009 Recurring mutations found by sequencing an acute myeloid leukemia genome.
19636000 2009 Isocitrate dehydrogenase 1 codon 132 mutation is an important prognostic biomarker in gliomas.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19554337 2009 Type and frequency of IDH1 and IDH2 mutations are related to astrocytic and oligodendroglial differentiation and age: a study of 1,010 diffuse gliomas.
19543740 2009 Combined molecular analysis of BRAF and IDH1 distinguishes pilocytic astrocytoma from diffuse astrocytoma.
19469031 2009 IDH1 and IDH2 mutations in gliomas.
19435942 2009 IDH1 mutations are present in the majority of common adult gliomas but rare in primary glioblastomas.
19411854 2009 Frequent IDH1 mutations in supratentorial primitive neuroectodermal tumors (sPNET) of adults but not children.
19378339 2009 Mutational analysis of IDH1 codon 132 in glioblastomas and other common cancers.
19359588 2009 Glioma-derived mutations in IDH1 dominantly inhibit IDH1 catalytic activity and induce HIF-1alpha.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19350208 2009 Mutations of IDH1 and IDH2 are not detected in brain metastases of colorectal cancer.
19340432 2009 Selective acquisition of IDH1 R132C mutations in astrocytomas associated with Li-Fraumeni syndrome.
19246647 2009 IDH1 mutations are early events in the development of astrocytomas and oligodendrogliomas.
19228619 2009 IDH1 and IDH2 mutations in gliomas.
19117336 2009 IDH1 mutations at residue p.R132 (IDH1(R132)) occur frequently in high-grade gliomas but not in other solid tumors.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18985363 2008 Analysis of the IDH1 codon 132 mutation in brain tumors.
18772396 2008 An integrated genomic analysis of human glioblastoma multiforme.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16756494 2006 Biochemistry of mammalian peroxisomes revisited.
16751257 2006 Housekeeping genes for phylogenetic analysis of eutherian relationships.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15936593 2005 Identification of differentially expressed proteins during human urinary bladder cancer progression.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15173171 2004 Structures of human cytosolic NADP-dependent isocitrate dehydrogenase reveal a novel self-regulatory mechanism of activity.
12923220 2003 IDH1 gene transcription is sterol regulated and activated by SREBP-1a and SREBP-2 in human hepatoma HepG2 cells: evidence that IDH1 may regulate lipogenesis in hepatic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10521434 1999 The human PICD gene encodes a cytoplasmic and peroxisomal NADP(+)-dependent isocitrate dehydrogenase.
9866202 1998 Cytosolic isocitrate dehydrogenase in humans, mice, and voles and phylogenetic analysis of the enzyme family.
7551812 1995 Fatty acid synthesis from glutamate in the adipose tissue of normal subjects and obese patients: an enzyme study.
4422176 1974 Chromosome assignments of genes in man using mouse-human somatic cell hybrids: Cytoplasmic isocitrate dehydrogenase (IDH 1) and malate dehydrogenase (MDH 1) to chromosomes 2.
4388365 1968 Intracellular location and genetic control of isozymes of NADP-dependent isocitrate dehydrogenase and malate dehydrogenase.
3861566 1985 Probable assignment of soluble isocitrate dehydrogenase (IDH1) to 2q33.3.