Property Summary

NCBI Gene PubMed Count 80
PubMed Score 215.78
PubTator Score 143.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Cancer 2346 3.756 1.9

Expression

  Differential Expression (32)

Disease log2 FC p
nephrosclerosis 1.057 2.8e-04
chronic lymphocytic leukemia 2.345 5.1e-04
malignant mesothelioma -3.000 4.1e-09
astrocytic glioma 2.700 6.7e-03
glioblastoma 3.000 4.9e-05
oligodendroglioma 1.900 9.8e-11
osteosarcoma 1.578 4.8e-02
posterior fossa group A ependymoma 1.800 1.0e-06
atypical teratoid / rhabdoid tumor 2.800 1.4e-06
tuberculosis -2.500 1.1e-05
primary pancreatic ductal adenocarcinoma 1.508 9.8e-03
non-small cell lung cancer -1.131 1.2e-09
intraductal papillary-mucinous adenoma (... -2.100 1.2e-03
intraductal papillary-mucinous carcinoma... -2.300 6.6e-04
intraductal papillary-mucinous neoplasm ... -2.600 2.0e-03
X-linked cerebral adrenoleukodystrophy 3.100 3.8e-02
Hydrolethalus syndrome -1.986 3.4e-02
lung cancer 1.700 1.7e-04
active Crohn's disease -1.805 3.8e-03
active ulcerative colitis -2.317 5.0e-03
diabetes mellitus -1.200 6.1e-03
interstitial cystitis -1.100 4.3e-03
adult high grade glioma 2.100 9.6e-05
group 4 medulloblastoma -1.100 1.1e-02
pilocytic astrocytoma 2.200 4.1e-07
lung adenocarcinoma -1.300 2.1e-06
Pick disease 1.100 3.6e-02
ovarian cancer -2.900 7.8e-12
pituitary cancer -1.900 1.3e-03
Down syndrome 1.100 9.3e-03
pancreatic cancer 1.500 5.6e-03
facioscapulohumeral dystrophy -2.000 2.8e-02

Gene RIF (50)

PMID Text
26384138 Upon Id3 transfection, A549 cells displayed decreased migratory and invasive capabilities, however, co-transfection of miRId3 and Id3 into A549 cells reversed the Id3-induced inhibitions of migratory and invasive capabilities.
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25665868 ID3 has a role in the acquisition of molecular stem cell-like signature in microvascular endothelial cells
25239768 ID3 plays a potential role in the underlying regulatory mechanisms of metabolic health in human obesity. [Review]
25090023 our data provide evidence that ID3 may play a critical role in regulating vascular endothelial cell survival and development of microvascular lesions induced by persistent environmental pollutants such as PCB153.
24655651 Epigenetic changes in ID3, in combination with experiences of maltreatment, may confer risk for depression in children.
24603695 Data indicate association of inhibitor of differentiation 3 (ID3) single nucleotide polymorphism rs11574 directly with coronary artery pathology.
24493312 the combined immunohistochemical detection of VPREB3 and ID3 is applicable to the routine diagnostic in case of mature aggressive B-cell lymphomas.
24343358 study shows that Id2, Id3 and Id4 are each able to overcome TGF-beta dependence, and establish a role for Ids as key mediators of TGF-beta melanomagenesis
24292846 Importantly, the distinct ID3 expression patterns in acute leukemias (AL) indicate a specific deregulation of ID3 in the various types of AL and may support subtyping of AL.
24222112 ID3 mutations are recurrent events in double-hit B-cell lymphomas.
24162774 HIV-1 gp120 upregulates the expression of inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3) in human B cells
23771884 Id proteins, and particularly Id1 and Id3, are critical downstream effectors of BMP signaling in pulmonary artery smooth muscle cell.
23768125 High ID3 expression is associated with medulloblastoma seeding and is a poor prognostic factor, especially in patients with Group 4 tumors
23342268 increased Id1 and Id3 expression attenuates all three cyclin-dependent kinase inhibitors (CDKN2B, -1A, and -1B) resulting in a more aggressive PCa phenotype.
23311395 Id1 and Id3 co-expression seems associated with a poor clinical outcome in patients with locally advanced NSCLC treated with definitive chemoradiotherapy
23143595 The findings suggested that cooperation between ID3 inactivation and immunoglobulin-MYC gene translocation is a hallmark of Burkitt lymphomagenesis.
23119064 Data indicate that ID2.K47A, ID2.Q55A and ID3.R52A, ID3.R60A had wildtype like expression levels in E. coli.
23060149 These findings suggest an essential role of Id1 and Id3 in TGFbeta1 effects on proliferation and migration in prostate cancer cells.
22882857 Overexpression of Id3 markedly promoted the proliferation and invasive capacity of MCF-7 cells; however, these effects were significantly suppressed by the overexpression of FHL2.
22698403 Data show that regulation of p21 by ID1 and ID3 is a central mechanism preventing the accumulation of excess DNA damage and subsequent functional exhaustion of cancer-initiating cells (C-ICs).
22151756 Overexpression of Id3 triggered apoptosis in A549 lung adenocarcinoma cells, implicating Id3 in negative control of tumor growth.
21993163 Older muscle contained significantly more transcript for Forkhead Box O 1 (FoxO1, p=0.001), Inhibitor of DNA binding 1 (ID1, p=0.009), and Inhibitor of DNA Binding 3 (ID3, p=0.043) than young muscle.
21975932 EGFR-AKT-Smad signaling promotes formation of glioma stem-like cells and tumor angiogenesis by ID3-driven cytokine induction.
21837949 The ID3 protein is expressed in prostate cancer, and is elevated with the increase of Gleason score.
21498546 the data establish dysregulation of the Id/bHLH axis as an early and sustained feature of ductal pathogenesis
21486943 Study uniquely identifies ID1 and ID3 as negative regulators of the hPSC-hematopoietic transition from a hemogenic to a committed hematopoietic fate, and demonstrates that this is conserved between hESCs and hiPSCs.
21191065 In serum samples of lung cancer patients, galectin 1-mediated Id3 induces expression of interleukin (IL)-10 in functionally altered signal pathways of monocytes and monocyte-derived dendritic cells.
21030215 ID3 plays a role as an apoptosis inducer in response to X-ray irradiation via the regulation of endogenous beta-catenin level.
20512523 expression of vFLIP decreased the expression levels of Id2 and Id3 as well as cyclin E and cyclin A compared with the vFLIP-null cells
20191379 Id1/3 peptide aptamer could represent a nontoxic exogenous agent that can significantly provoke antiproliferative and apoptotic effects in breast cancer cells, which are associated with deregulated expression of Id1 and Id3.
20185798 Results provide novel evidence that Id3 is an atheroprotective factor and link a common SNP in the human ID3 gene to loss of Id3 function and increased carotid intima-media thickness.
20185798 Observational study of gene-disease association. (HuGE Navigator)
20080245 The level of Id-3 protein expression was associated with the malignant potential of gastric tumors.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19515385 role in the development of peritoneal metastasis of pancreatic cancer
19477940 RNA interference demonstrated that Id3 regulates differentiation and cell cycle (increased Neuro-D6 and p21 mRNA) in neuroblastoma cells
19054058 There is a mechanism whereby reactive oxygen species upregulation of Id3 relieves repression of bax via E-box-binding factors.
18477564 RhoA/Rho-associated kinase signaling plays positive and negative roles in myogenic differentiation, mediated by MRTF-A/Smad-dependent transcription of the Id3 gene in a differentiation stage-specific manner
18374504 Observational study of gene-disease association. (HuGE Navigator)
18281048 estrogen-induced tube formation in vascular endothelial cells requires the presence of Id3, a member of the helix-loop-helix family of transcriptional factors and estrogen increases Id3 phosphorylation via a redox-dependent process
17537403 PLZF upregulates apoptosis-inducer TP53INP1, ID1, and ID3 genes, and downregulates the apoptosis-inhibitor TERT gene
16682435 ID proteins (ID1, ID2, ID3 and ID4) were significantly increased in Mecp2-deficient Rett syndrome brain; ID genes are ideal targets for MeCP2 regulation of neuronal maturation that may explain the molecular pathogenesis of Rett syndrome
16449966 ultraviolet radiation-induced apoptosis of immortalized keratinocytes is at least in part due to Id3 upregulation in these cells
16271072 Id1, 3 double-knockdown significantly impaired the ability of gastric cancer cells to form peritoneal metastasis
15645115 Id1, 2 and 3 might play a role in the early stages of hepatocarcinogenesis, but not in the development of advanced carcinoma, and might consequently be related to HCC dedifferentiation
15583422 Observational study of gene-disease association. (HuGE Navigator)
15494533 Overexpression of Id3 enhances expression of ICAM-1 and E-selectin, and induces angiogenic processes such as transmigration, matrix metalloproteinase-2 and -9 expression, and tube formation in cultured vascular endothelial cells.
15370294 Fluvastatin did not regulate p21 and p27, but down-regulated Id3 and p53 slightly.
12952978 nuclear Id protein acts by sequestering pools of transiently diffusing bHLH protein to prevent reassociation with chromatin domains

AA Sequence

MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL      1 - 70
QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELTPELVISNDKRSFCH                          71 - 119
//

Text Mined References (82)

PMID Year Title
26384138 2015 Effects of upregulation of Id3 in human lung adenocarcinoma cells on proliferation, apoptosis, mobility and tumorigenicity.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25665868 2015 ID3 contributes to the acquisition of molecular stem cell-like signature in microvascular endothelial cells: its implication for understanding microvascular diseases.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25416956 2014 A proteome-scale map of the human interactome network.
25239768 2014 The potential role of inhibitor of differentiation-3 in human adipose tissue remodeling and metabolic health.
25090023 2014 PCB153-induced overexpression of ID3 contributes to the development of microvascular lesions.
24655651 2014 Child abuse, depression, and methylation in genes involved with stress, neural plasticity, and brain circuitry.
24603695 2014 A functionally significant polymorphism in ID3 is associated with human coronary pathology.
24493312 2014 The combined expression of VPREB3 and ID3 represents a new helpful tool for the routine diagnosis of mature aggressive B-cell lymphomas.
24343358 2014 Id2, Id3 and Id4 overcome a Smad7-mediated block in tumorigenesis, generating TGF-?-independent melanoma.
24292846 2014 ID2 and ID3 protein expression mirrors granulopoietic maturation and discriminates between acute leukemia subtypes.
24222112 2013 ID3 mutations are recurrent events in double-hit B-cell lymphomas.
23771884 2013 Id proteins are critical downstream effectors of BMP signaling in human pulmonary arterial smooth muscle cells.
23768125 2013 ID3 contributes to cerebrospinal fluid seeding and poor prognosis in medulloblastoma.
23342268 2012 Id1 and Id3 expression is associated with increasing grade of prostate cancer: Id3 preferentially regulates CDKN1B.
23311395 2013 Id1 and Id3 co-expression correlates with clinical outcome in stage III-N2 non-small cell lung cancer patients treated with definitive chemoradiotherapy.
23143595 2012 Recurrent mutation of the ID3 gene in Burkitt lymphoma identified by integrated genome, exome and transcriptome sequencing.
23119064 2012 A divalent ion is crucial in the structure and dominant-negative function of ID proteins, a class of helix-loop-helix transcription regulators.
23060149 2013 Inhibitor of differentiation 1 (Id1) and Id3 proteins play different roles in TGF? effects on cell proliferation and migration in prostate cancer cells.
22882857 2012 FHL2 inhibits the Id3-promoted proliferation and invasive growth of human MCF-7 breast cancer cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22698403 2012 ID1 and ID3 regulate the self-renewal capacity of human colon cancer-initiating cells through p21.
22151756 2012 Overexpression of Id3 induces apoptosis of A549 human lung adenocarcinoma cells.
21993163 2011 Differential gene expression of FoxO1, ID1, and ID3 between young and older men and associations with muscle mass and function.
21975932 2011 EGFR-AKT-Smad signaling promotes formation of glioma stem-like cells and tumor angiogenesis by ID3-driven cytokine induction.
21837949 2011 [Expression of ID3 protein in prostate cancer and its clinicopathological significance].
21498546 2011 The Id3/E47 axis mediates cell-cycle control in human pancreatic ducts and adenocarcinoma.
21486943 2011 ID1 and ID3 represent conserved negative regulators of human embryonic and induced pluripotent stem cell hematopoiesis.
21191065 2011 Lung cancer-derived galectin-1 mediates dendritic cell anergy through inhibitor of DNA binding 3/IL-10 signaling pathway.
21030215 2010 ID3 mediates X-ray-induced apoptosis of keratinocytes through the regulation of ?-catenin.
20861012 2010 The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.
20512523 2010 Human herpesvirus 8 viral FLICE-inhibitory protein retards cell proliferation via downregulation of Id2 and Id3 expression.
20191379 2010 Targeting Id1 and Id3 by a specific peptide aptamer induces E-box promoter activity, cell cycle arrest, and apoptosis in breast cancer cells.
20185798 2010 Id3 is a novel atheroprotective factor containing a functionally significant single-nucleotide polymorphism associated with intima-media thickness in humans.
20080245 2011 Expression and prognostic values of Id-1 and Id-3 in gastric adenocarcinoma.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19515385 2010 Id1/Id3 knockdown inhibits metastatic potential of pancreatic cancer.
19477940 2009 Fibroblast growth factor 2 reactivates G1 checkpoint in SK-N-MC cells via regulation of p21, inhibitor of differentiation genes (Id1-3), and epithelium-mesenchyme transition-like events.
19054058 2009 UVB upregulates the bax promoter in immortalized human keratinocytes via ROS induction of Id3.
18477564 2008 Rho/Rho-associated kinase signal regulates myogenic differentiation via myocardin-related transcription factor-A/Smad-dependent transcription of the Id3 gene.
18374504 2008 Influence of multiple genetic polymorphisms on genitourinary morbidity after carbon ion radiotherapy for prostate cancer.
18281048 2008 Estrogen-induced redox sensitive Id3 signaling controls the growth of vascular cells.
17537403 2007 Identification of apoptosis-related PLZF target genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16682435 2006 Inhibitors of differentiation (ID1, ID2, ID3 and ID4) genes are neuronal targets of MeCP2 that are elevated in Rett syndrome.
16449966 2006 Id3 induces a caspase-3- and -9-dependent apoptosis and mediates UVB sensitization of HPV16 E6/7 immortalized human keratinocytes.
16271072 2005 Targeting Id1 and Id3 inhibits peritoneal metastasis of gastric cancer.
15645115 2005 Expression of Id proteins in human hepatocellular carcinoma: relevance to tumor dedifferentiation.
15583422 2004 Analysis of candidate genes for prostate cancer.
15494533 2004 Crucial role of inhibitor of DNA binding/differentiation in the vascular endothelial growth factor-induced activation and angiogenic processes of human endothelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15370294 Inhibitors of differentiation/DNA binding proteins Id1 and Id3 are regulated by statins in endothelial cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14627819 2003 Synergistic activation of the human orphan nuclear receptor SHP gene promoter by basic helix-loop-helix protein E2A and orphan nuclear receptor SF-1.
12952978 2003 Id proteins negatively regulate basic helix-loop-helix transcription factor function by disrupting subnuclear compartmentalization.
12547711 2003 Global expression profiling of fibroblast responses to transforming growth factor-beta1 reveals the induction of inhibitor of differentiation-1 and provides evidence of smooth muscle cell phenotypic switching.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054881 2002 Immunoprecipitation techniques for the analysis of transcription factor complexes.
11940648 2002 The MyoD-inducible p204 protein overcomes the inhibition of myoblast differentiation by Id proteins.
11756408 2002 Modulation of basic helix-loop-helix transcription complex formation by Id proteins during neuronal differentiation.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
10593873 1999 Degradation of Id proteins by the ubiquitin-proteasome pathway.
10585876 1999 Functional antagonism between inhibitor of DNA binding (Id) and adipocyte determination and differentiation factor 1/sterol regulatory element-binding protein-1c (ADD1/SREBP-1c) trans-factors for the regulation of fatty acid synthase promoter in adipocytes.
10022839 1999 Id helix-loop-helix proteins inhibit nucleoprotein complex formation by the TCF ETS-domain transcription factors.
9821964 1998 The helix-loop-helix transcription factors Id1 and Id3 have a functional role in control of cell division in human normal and neoplastic chondrocytes.
9525934 1998 Lymphoid-specific expression of the Id3 gene in hematopoietic cells. Selective antagonism of E2A basic helix-loop-helix protein associated with Id3-induced differentiation of erythroleukemia cells.
9372912 1997 Regulation of Id3 cell cycle function by Cdk-2-dependent phosphorylation.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
8999959 1997 Physical and functional interactions between the transcriptional inhibitors Id3 and ITF-2b. Evidence toward a novel mechanism regulating muscle-specific gene expression.
8804437 1996 Attenuated function of a variant form of the helix-loop-helix protein, Id-3, generated by an alternative splicing mechanism.
8798572 1996 Nuclear localization and regulation of Id protein through an E protein-mediated chaperone mechanism.
8759016 1996 E2A basic-helix-loop-helix transcription factors are negatively regulated by serum growth factors and by the Id3 protein.
8645731 1996 A homology model of the Id-3 helix-loop-helix domain as a basis for structure-function predictions.
8632670 1995 Expression of Id2 and Id3 mRNA in human lymphocytes.
8437843 1993 An immediate early human gene encodes an Id-like helix-loop-helix protein and is regulated by protein kinase C activation in diverse cell types.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7828896 1994 Structural organisation and chromosomal mapping of the human Id-3 gene.
7821789 1994 Construction of a human full-length cDNA bank.
7777541 1995 A region of consistent deletion in neuroblastoma maps within human chromosome 1p36.2-36.3.
1628620 1992 Mutually exclusive expression of a helix-loop-helix gene and N-myc in human neuroblastomas and in normal development.