Property Summary

NCBI Gene PubMed Count 114
PubMed Score 294.48
PubTator Score 234.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.702 3.7e-02
malignant mesothelioma -4.800 1.4e-09
oligodendroglioma 2.200 3.7e-02
esophageal adenocarcinoma 1.400 2.5e-02
psoriasis -1.100 6.0e-05
glioblastoma 2.300 1.6e-03
osteosarcoma 1.582 4.6e-06
chronic lymphosyte leukemia -2.700 3.7e-09
group 4 medulloblastoma -3.400 4.9e-07
cystic fibrosis -2.000 1.0e-04
astrocytoma 2.400 6.7e-03
medulloblastoma, large-cell -3.600 2.2e-07
Duchenne muscular dystrophy 1.215 9.4e-07
autosomal dominant Emery-Dreifuss muscul... 1.302 3.3e-03
juvenile dermatomyositis 1.500 4.4e-10
acute quadriplegic myopathy 1.222 2.4e-04
primary pancreatic ductal adenocarcinoma 1.116 2.6e-02
non-small cell lung cancer -2.377 3.5e-22
colon cancer -1.500 2.8e-03
posterior fossa group A ependymoma 1.200 1.5e-02
nasopharyngeal carcinoma 1.200 5.0e-05
lung adenocarcinoma -1.208 7.8e-04
mucosa-associated lymphoid tissue lympho... 1.271 3.3e-02
invasive ductal carcinoma 1.100 1.0e-02
ovarian cancer -2.800 2.6e-07
pituitary cancer -1.800 6.0e-04

 GO Function (1)

Gene RIF (80)

PMID Text
26735018 ID2 binds to the VHL ubiquitin ligase complex, displaces VHL-associated Cullin 2, and impairs HIF2alpha ubiquitylation and degradation
25778840 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25773386 Downregulation of the Id2 gene by RNAi could increase the chemosensitivity of glioblastoma cells. Id2 could be a good molecular target for glioblastoma gene therapy.
25771836 High Id2 expression is associated with Neuroblatoma.
25076250 ID2 was involved in cancer cell responses to Arsenic Tri-Oxide (ATO). Increased expression of ID2 was found in cancer cells following ATO treatment. In addition, specific silencing of ID2 enhanced cell apoptosis induced by ATO treatment.
24425046 Id2 overexpression in neural stem cells is associated with inhibition of the Notch effector Hey1 and glioma formation in the brains of mice.
24376712 role of Id2-TGFbeta crosstalk in reversible adaptive plasticity in neuroblastoma
24343358 study shows that Id2, Id3 and Id4 are each able to overcome TGF-beta dependence, and establish a role for Ids as key mediators of TGF-beta melanomagenesis
24292846 Importantly, the distinct ID2 expression patterns in acute leukemias (AL) indicate a specific deregulation of ID2 in the various types of AL and may support subtyping of AL.
23825313 PreBII large cells in adults, but not in children, showed highly upregulated expression of the differentiation inhibitor, inhibitor of DNA binding 2 (ID2), in absence of changes in expression of the ID2-binding partner E2A.
23645773 Higher ID2 expression was associated with advanced breast cancer.
23403953 ID2 expression affects the susceptibility hepatoma cell lines to an HDAC inhibitor by regulating the expression of anti-apoptotic genes.
23399020 upregulated H19 increases bladder cancer growth by regulating ID2 expression
23320068 A reduction in Id2 is critical for transforming growth factor (TGF)beta1-induced alpha-SMA expression in renal proximal tubule epithelial cells but is not sufficient in it self to induce alphaSMA (smooth muscle actin) even in the context of reduced E-cadherin.
23143248 preliminary X-ray data analysis of the human ID2 homodimer
23119064 Data indicate that ID2.K47A, ID2.Q55A and ID3.R52A, ID3.R60A had wildtype like expression levels in E. coli.
22835384 Id2 induces squamous cell carcinoma tumor growth and proliferation through the NF-kappaB/cyclin D1 pathway.
22745378 A critical role of Id2 is revealed in the control of effector CD4 T cell population size and the development of T helper (Th) cell type 17-mediated autoimmune encephalomyelitis.
22580608 using Bcl-3 knockdown in prostate cancer cells, identified the inhibitor of DNA-binding (Id) family of helix-loop-helix proteins as potential Bcl-3-regulated genes
22551584 ID2 in nucleus was increased in nasopharyngeal carcinoma when compared with that in normal nasopharynx tissues. Higher expression level of nuclear ID2 was significantly associated with tumor size, lymph node metastasis, and clinical stage.
22380883 Id2 and Id4 regulated glioblastoma multiforme neurosphere differentiation through downregulating of another bHLH family member, the oligodendroglial lineage-associated transcription factors (Olig) 1 and 2
22253220 This review reported that ID2 protein is a negative transcription factor regulating oligodendroglia differentiation.
21927809 Id2 mutations do not seem to be involved in ureteropelvic junction obstruction.
21608079 Findings indicate that Id2 functions as a proproliferative gene that antagonizes p53-mediated cell cycle regulation in NPCs and may contribute to the malignant proliferation of glioma-derived tumor stem cells.
21478550 Large scale RNAi screen reveals that the inhibitor of DNA binding 2 (ID2) protein is repressed by p53 family member p63 and functions in human keratinocyte differentiation.
20876741 AMP-activated protein kinase (PRKAA1/2, aka AMPK) mediates the stress-induced proteasome-dependent loss of ID2 at high stress levels.
20861012 ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20565746 major differentiation factors of the NK-cell lineage, including HOXA9, HOXA10 and ID2, were (de)regulated via PRC2 which therefore contributes to T-cell leukemogenesis.
20512523 expression of vFLIP decreased the expression levels of Id2 and Id3 as well as cyclin E and cyclin A compared with the vFLIP-null cells
20483740 T cell development is impaired by Id2, most likely by sequestering HEB, whereas NK cell development is promoted by increasing a pool of CD1a-CD5+ NK cell progenitors, which together with IL-15 differentiate into mature NK cells
20388805 Metastatic tumor cells overexpress c-myc, leading to upregulation of Id2 expression; the aberrantly elevated amount of Id2 represses SEMA3F expression and, as a consequence, enhances the ability of tumor cells to migrate and invade.
19950294 Hypoxia-induced ID-2 may contribute to joint destruction in rheumatoid arthritis patients by promoting synovial fibroblast-dependent osteoclastogenesis.
19733838 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19423615 Neuroblastoma cell adaptation to hypoxia involves the modulation of HIF1alpha and VEGF expression, nuclear translocation of ID1 and ID2 transcription factors, and activation of a gene expression program consistent with pro-metastatic events.
19417068 Ectopic FHL2 expression in neuroblastoma cells markedly reduces the transcriptional and cell-cycle promoting functions of Id2.
19368689 transition to increased aggressiveness in melanoma cells requires Id2 upregulation to suppress TGF-beta induction of p15(Ink4b) and thus help to circumvent TGF-beta-mediated inhibition of proliferation.
19330020 Targeting Id dimerization may therefore be effective for triggering differentiation and restraining neuroblastoma cell tumorigenicity.
19321746 Genes for Fra2, Id2, and CSF1-receptor are deregulated, regardless of whether the in anaplastic large cell lymphoma contains the t(2;5).
19269192 Id2-deficient mice display increased CD8+ T cell apoptosis resulting in fewer effector and memory T cells
19260835 association between Id2 and lymphangiogenesis is suggested by co-localization of Id2, VEGFR-3 and lymphatic vascular endothelial hyaluronan receptor-1
19257909 Overexpression of Id2 in ERalpha-positive epithelial tumor cells indeed increases the cells' invasive potential through a mechanism independent of dimerization to basic helix-loop-helix factors.
19180920 VEGF165 may partially inhibit TGF-beta1-induced epithelial-mesenchymal transition by upregulating the expressions of BMP-7 and Id2.
19129913 the relationship between the expression of ID2 in non-small cell lung cancer (NSCLC) patients and the clinicopathological features and prognosis of these patients
19099554 ID2 protein was expressed in 83.3% of this group of classical Hodgkin lymphoma, staining strongly in both cytoplasm and nucleus of the Hodgkin and Reed-Sternberg (HRS) cells, and was positively correlated with EBV-LMP1
19043732 This study shows that Id2 is an important regulator of vasculogenic mimicry. Specifically, Id2 affects VE-cadherin expression, and is critical for the formation of vasculogenic-like networks.
19010462 Results suggest that in lymphoma cells overexpressing growth hormone, there is an upregulation of Id2 protein that appears to involve STAT protein activity.
18806828 Id2 is upregulated in CRC, and is important in promoting cell survival.
18490653 activation of protein kinase A elicits an immediate response through induction of genes such as ID2 and FosB, followed by sustained secretion of bone-related cytokines such as BMP-2, IGF-1, and IL-11
18436795 The integration of signals at the level of Id gene expression may contribute to the pathogenesis of familial pulmonary arterial hypertension
18281534 ID2 plays a significant role in the metastatic process during progression of HCC. This action might be explained, at least in part, by altered cell mobility due to decreased secretion of VEGF.
18085637 Id2 commonly is overexpressed in highly proliferative T-cell lymphomas, and its expression may result from transcriptional activation of myc in these tumors.
18000500 The high levels of Id-2 expression in both cytoplasmic and nuclear regions predicted longer patient survival, and Id-2 may be used for prognostication for oesophageal squamous cell carcinoma (ESCC) patients.
17631285 Our data demonstrate that IL-1beta-induced Id2 expression in VSMC is mediated by the transcription factor Egr-1 in VSMC.
17630394 RFX1 mediates the immediate early response of the Id2 gene by serum stimulation and suggest that the function of RFX1 is regulated intramolecularly in its suppression in growth-arrested cells.
17431671 OLIG2 expression was predominant over ID2 expression in oligodendroglial tumors, while ID2 expression was predominant over OLIG2 expression in astrocytic tumors.
16877363 ID2, which can inactivate E2A and perhaps PAX5, is not detectable in normal B cells but is strongly and uniformly expressed in Hodgkin-Reed/Sternberg (HRS) cells of all cases of classical Hodgkin's lymphoma (HL).
16810178 findings indicate that deregulated Id activity might be useful to reprogramme quiescent neurons into the axonal growth mode
16705184 Global gene expression analysis in neuroblastoma cells engineered to acutely express the E protein E47 and Id2, showed that p57Kip2 is a target of E47.
16682435 ID proteins (ID1, ID2, ID3 and ID4) were significantly increased in Mecp2-deficient Rett syndrome brain; ID genes are ideal targets for MeCP2 regulation of neuronal maturation that may explain the molecular pathogenesis of Rett syndrome
16549780 enigma homolog enigma-like LIM domain protein is a restraining factor of the oncogenic activity of Id proteins in neural tumors
16311606 PKD2 regulates the cell cycle through direct interaction with Id2; Id2 expression suppresses the induction of a cdk inhibitor, p21, by either PKD1 or PDK2. The PDK2-Id2 interaction is regulated by PDK1-dependent phosphorylation of PDK2.
16223775 PU.1 and Id2 modulate lineage options of langerhans cell precursors, downstream of TGF-beta1.
15744343 These results indicate ID1 and ID2 are important retinoic acid responsive genes in acute promyelocytic leukemia [APL], and suggest that inhibition of specific bHLH transcription factor complexes may play a role in the therapeutic effect of ATRA in APL
15701714 Constitutive Id2 expression accelerates final maturation of both eosinophils and neutrophils, whereas inhibition of Id2 expression blocks differentiation of both lineages
15691830 reenters the cell cycle after radiation-induced cell cycle arrest to permit the recovery of keratinocytes
15645115 Id1, 2 and 3 might play a role in the early stages of hepatocarcinogenesis, but not in the development of advanced carcinoma, and might consequently be related to HCC dedifferentiation
15252039 Hypoxia-induced ID2 expression could play a significant role in the previously observed dedifferentiation of hypoxic neuroblastoma cells, which in a clinical setting could lead to less mature and more aggressive tumors.
15041724 Id-1 and Id-2 proteins control prostate cancer cell phenotypes and could serve as molecular markers of aggressive human prostate cancer.
14733935 Id2 developmental regulator degradation is targeted via N-terminal ubiquitination
14612502 ID-2 appears to act as an important protein for the maintenance of a differentiated and noninvasive phenotype in normal and transformed breast cells.
14582708 The decreased level of Id2 was associated with growth suppression and does support the prevalent conception of the action of Id2 as a stimulator of cell growth
12824180 Mad expression and Id2 down-regulation are important events during the TGF-beta cytostatic program in epithelial cells.
12670915 Transcriptional regulation of ID2 by the MycN oncoprotein is unlikely to be a seminal molecular event resulting in a highly malignant neuroblastoma phenotype.
12598895 Id2 is up-regulated during dendritic cells development in vitro and crucial for the development of distinct dendritic cells subsets in vivo
12545167 We found no correlation between MYCN and ID2 expression in neuroblastoma cell lines or tumor specimens. However, we did find a significant positive correlation between MYC and ID2 expressions in both MYCN-amplified and single-copy tumor specimens
12527902 upregulation is mediated by the chimeric EWS/ets protein in Ewing sarcoma
12447693 determination as a novel target of transcriptional activation by EWS-ETS fusion proteins in Ewing family tumors
11782392 Id2 is critical for cellular proliferation and is the oncogenic effector of N-myc in human neuroblastoma.

AA Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVID      1 - 70
YILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG           71 - 134
//

Text Mined References (116)

PMID Year Title
26735018 2016 An ID2-dependent mechanism for VHL inactivation in cancer.
25778840 2015 Inhibitor of differentiation 4 (ID4) acts as an inhibitor of ID-1, -2 and -3 and promotes basic helix loop helix (bHLH) E47 DNA binding and transcriptional activity.
25773386 2015 Downregulation of Id2 increases chemosensitivity of glioma.
25771836 2015 The Role of Id2 Protein in Neuroblatoma in Children.
25076250 Upregulation of ID2 antagonizes arsenic trioxide-induced antitumor effects in cancer cells.
24425046 2014 Id2 mediates oligodendrocyte precursor cell maturation arrest and is tumorigenic in a PDGF-rich microenvironment.
24376712 2013 A mechanism linking Id2-TGF? crosstalk to reversible adaptive plasticity in neuroblastoma.
24343358 2014 Id2, Id3 and Id4 overcome a Smad7-mediated block in tumorigenesis, generating TGF-?-independent melanoma.
24292846 2014 ID2 and ID3 protein expression mirrors granulopoietic maturation and discriminates between acute leukemia subtypes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23825313 2013 Increased ID2 levels in adult precursor B cells as compared with children is associated with impaired Ig locus contraction and decreased bone marrow output.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23645773 2013 The mRNA expression of inhibitors of DNA binding-1 and -2 is associated with advanced tumour stage and adverse clinical outcome in human breast cancer.
23403953 2013 Susceptibility of hepatoma-derived cells to histone deacetylase inhibitors is associated with ID2 expression.
23399020 2013 Upregulated H19 contributes to bladder cancer cell proliferation by regulating ID2 expression.
23320068 2013 Smad mediated regulation of inhibitor of DNA binding 2 and its role in phenotypic maintenance of human renal proximal tubule epithelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23143248 2012 Cloning, purification and preliminary X-ray data analysis of the human ID2 homodimer.
23119064 2012 A divalent ion is crucial in the structure and dominant-negative function of ID proteins, a class of helix-loop-helix transcription regulators.
22835384 2012 Id2 regulates the proliferation of squamous cell carcinoma in vitro via the NF-?B/Cyclin D1 pathway.
22745378 2012 Transcriptional regulator Id2 is required for the CD4 T cell immune response in the development of experimental autoimmune encephalomyelitis.
22580608 2013 Expression of Id proteins is regulated by the Bcl-3 proto-oncogene in prostate cancer.
22551584 2012 Overexpressed DNA-binding protein inhibitor 2 as an unfavorable prognosis factor promotes cell proliferation in nasopharyngeal carcinoma.
22453338 2012 Structure of a dominant-negative helix-loop-helix transcriptional regulator suggests mechanisms of autoinhibition.
22380883 2012 Regulation of glioblastoma multiforme stem-like cells by inhibitor of DNA binding proteins and oligodendroglial lineage-associated transcription factors.
22253220 2012 ID2: A negative transcription factor regulating oligodendroglia differentiation.
22075330 2012 A genome-wide association study of plasma total IgE concentrations in the Framingham Heart Study.
21927809 2012 Mutation screening of BMP4 and Id2 genes in Chinese patients with congenital ureteropelvic junction obstruction.
21608079 2011 p53 directly represses Id2 to inhibit the proliferation of neural progenitor cells.
21478550 2011 Large scale RNAi screen reveals that the inhibitor of DNA binding 2 (ID2) protein is repressed by p53 family member p63 and functions in human keratinocyte differentiation.
20876741 2010 Cellular stress causes reversible, PRKAA1/2-, and proteasome-dependent ID2 protein loss in trophoblast stem cells.
20861012 2010 The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20565746 2010 Polycomb repressor complex 2 regulates HOXA9 and HOXA10, activating ID2 in NK/T-cell lines.
20512523 2010 Human herpesvirus 8 viral FLICE-inhibitory protein retards cell proliferation via downregulation of Id2 and Id3 expression.
20483740 2010 Synergy between IL-15 and Id2 promotes the expansion of human NK progenitor cells, which can be counteracted by the E protein HEB required to drive T cell development.
20388805 2010 Id2 promotes tumor cell migration and invasion through transcriptional repression of semaphorin 3F.
19950294 2009 Inhibitor of DNA binding/differentiation 2 induced by hypoxia promotes synovial fibroblast-dependent osteoclastogenesis.
19733838 2009 Case-control study of six genes asymmetrically expressed in the two cerebral hemispheres: association of BAIAP2 with attention-deficit/hyperactivity disorder.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19423615 2009 Activation of a prometastatic gene expression program in hypoxic neuroblastoma cells.
19417068 2009 FHL2 interacts with and acts as a functional repressor of Id2 in human neuroblastoma cells.
19368689 2009 Id2 suppression of p15 counters TGF-beta-mediated growth inhibition of melanoma cells.
19330020 2009 Targeting Id protein interactions by an engineered HLH domain induces human neuroblastoma cell differentiation.
19321746 2009 Gene deregulation and spatial genome reorganization near breakpoints prior to formation of translocations in anaplastic large cell lymphoma.
19269192 2009 Surviving the crash: transitioning from effector to memory CD8+ T cell.
19260835 2009 ID2-VEGF-related pathways in the pathogenesis of Kaposi's sarcoma: a link disrupted by rapamycin.
19257909 2009 Id2 promotes the invasive growth of MCF-7 and SKOV-3 cells by a novel mechanism independent of dimerization to basic helix-loop-helix factors.
19180920 2008 [Relationship between the effect of vascular endothelial growth factor on epithelial-mesenchymal transition of HK-2 cells and the expressions of bone morphogenetic protein-7 and inhibitor of DNA binding/differentiation].
19129913 2009 The intracellular localization of ID2 expression has a predictive value in non small cell lung cancer.
19099554 2008 Aberrant expression of ID2 protein and its correlation with EBV-LMP1 and P16(INK4A) in classical Hodgkin lymphoma in China.
19043732 2009 Molecular regulation of vasculogenic mimicry in human uveal melanoma cells: role of helix-loop-helix Id2 (inhibitor of DNA binding 2).
19010462 2009 Regulation of Id2 expression in EL4 T lymphoma cells overexpressing growth hormone.
18806828 2008 Therapeutic targeting of Id2 reduces growth of human colorectal carcinoma in the murine liver.
18490653 2008 cAMP/PKA pathway activation in human mesenchymal stem cells in vitro results in robust bone formation in vivo.
18436795 2008 Mutations in bone morphogenetic protein type II receptor cause dysregulation of Id gene expression in pulmonary artery smooth muscle cells: implications for familial pulmonary arterial hypertension.
18281534 2008 Decreased ID2 promotes metastatic potentials of hepatocellular carcinoma by altering secretion of vascular endothelial growth factor.
18085637 2008 The helix-loop-helix protein Id2 is expressed differentially and induced by myc in T-cell lymphomas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18000500 2007 Id-1 and Id-2 are markers for metastasis and prognosis in oesophageal squamous cell carcinoma.
17631285 2007 Interleukin-1 beta-induced Id2 gene expression is mediated by Egr-1 in vascular smooth muscle cells.
17630394 2007 RFX1 mediates the serum-induced immediate early response of Id2 gene expression.
17431671 2007 Predominant expression of OLIG2 over ID2 in oligodendroglial tumors.
16877363 2006 Aberrant expression of ID2, a suppressor of B-cell-specific gene expression, in Hodgkin's lymphoma.
16810178 2006 Degradation of Id2 by the anaphase-promoting complex couples cell cycle exit and axonal growth.
16705184 2006 E Proteins and Id2 converge on p57Kip2 to regulate cell cycle in neural cells.
16682435 2006 Inhibitors of differentiation (ID1, ID2, ID3 and ID4) genes are neuronal targets of MeCP2 that are elevated in Rett syndrome.
16549780 2006 The protein ENH is a cytoplasmic sequestration factor for Id2 in normal and tumor cells from the nervous system.
16311606 2005 Polycystin-1 and polycystin-2 regulate the cell cycle through the helix-loop-helix inhibitor Id2.
16223775 2006 Differential involvement of PU.1 and Id2 downstream of TGF-beta1 during Langerhans-cell commitment.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15744343 2005 ID1 and ID2 are retinoic acid responsive genes and induce a G0/G1 accumulation in acute promyelocytic leukemia cells.
15701714 2005 Differential regulation of granulopoiesis by the basic helix-loop-helix transcriptional inhibitors Id1 and Id2.
15691830 2005 Id2 reverses cell cycle arrest induced by {gamma}-irradiation in human HaCaT keratinocytes.
15645115 2005 Expression of Id proteins in human hepatocellular carcinoma: relevance to tumor dedifferentiation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252039 2004 Induction of ID2 expression by hypoxia-inducible factor-1: a role in dedifferentiation of hypoxic neuroblastoma cells.
15249128 2004 Id2 is a primary partner for the E2-2 basic helix-loop-helix transcription factor in the human placenta.
15041724 2004 Id-1 and Id-2 proteins as molecular markers for human prostate cancer progression.
14752053 2004 Orphan nuclear receptor small heterodimer partner, a novel corepressor for a basic helix-loop-helix transcription factor BETA2/neuroD.
14733935 2004 Degradation of the Id2 developmental regulator: targeting via N-terminal ubiquitination.
14627819 2003 Synergistic activation of the human orphan nuclear receptor SHP gene promoter by basic helix-loop-helix protein E2A and orphan nuclear receptor SF-1.
14612502 2003 Role of Id-2 in the maintenance of a differentiated and noninvasive phenotype in breast cancer cells.
14582708 2003 Down-regulation of ID2 by all-trans retinoic acid in monocytic leukemia cells (THP-1).
12878164 2003 Intracellular redistribution of nuclear and nucleolar proteins during differentiation of 32D murine hemopoietic cells.
12824180 2003 Mad upregulation and Id2 repression accompany transforming growth factor (TGF)-beta-mediated epithelial cell growth suppression.
12670915 2003 ID2 expression is not associated with MYCN amplification or expression in human neuroblastomas.
12657241 2003 Expression of Id2 mRNA in neuroblastoma and normal ganglion.
12598895 2003 Transcriptional profiling identifies Id2 function in dendritic cell development.
12545167 2003 ID2 expression in neuroblastoma does not correlate to MYCN levels and lacks prognostic value.
12527902 2003 Upregulation of Id2, an oncogenic helix-loop-helix protein, is mediated by the chimeric EWS/ets protein in Ewing sarcoma.
12483209 2003 Essential role of Id2 in negative regulation of IgE class switching.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12447693 2002 The Id2 gene is a novel target of transcriptional activation by EWS-ETS fusion proteins in Ewing family tumors.
11940648 2002 The MyoD-inducible p204 protein overcomes the inhibition of myoblast differentiation by Id proteins.
11756408 2002 Modulation of basic helix-loop-helix transcription complex formation by Id proteins during neuronal differentiation.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11560778 2001 Characterization of a basic helix-loop-helix protein, ABF-1: nuclear localization, transcriptional properties, and interaction with Id-2.
11301021 2001 A role for the helix-loop-helix protein Id2 in the control of oligodendrocyte development.
11134340 2001 Id helix-loop-helix proteins antagonize pax transcription factor activity by inhibiting DNA binding.
11034201 2000 Id2 is a retinoblastoma protein target and mediates signalling by Myc oncoproteins.
10915743 2000 Human homologue of maid: A dominant inhibitory helix-loop-helix protein associated with liver-specific gene expression.
10891368 2000 A cysteine residue in the helix-loop-helix domain of Id2 is critical for homodimerization and function.
10585876 1999 Functional antagonism between inhibitor of DNA binding (Id) and adipocyte determination and differentiation factor 1/sterol regulatory element-binding protein-1c (ADD1/SREBP-1c) trans-factors for the regulation of fatty acid synthase promoter in adipocytes.
10502414 1999 Dimerization of the docking/adaptor protein HEF1 via a carboxy-terminal helix-loop-helix domain.
10067894 1999 Development of peripheral lymphoid organs and natural killer cells depends on the helix-loop-helix inhibitor Id2.
10022839 1999 Id helix-loop-helix proteins inhibit nucleoprotein complex formation by the TCF ETS-domain transcription factors.
9242638 1997 Differential interactions of Id proteins with basic-helix-loop-helix transcription factors.
9029153 1997 Cdk2-dependent phosphorylation of Id2 modulates activity of E2A-related transcription factors.
8649364 1996 Id2 specifically alters regulation of the cell cycle by tumor suppressor proteins.
8586447 1995 Chromosomal assignment of human ID1 and ID2 genes.
8294468 1994 Id-related genes encoding helix-loop-helix proteins are required for G1 progression and are repressed in senescent human fibroblasts.
8224921 1993 Two distinct cDNA sequences encoding the human helix-loop-helix protein Id2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7926730 1994 The helix-loop-helix protein Id-2 enhances cell proliferation and binds to the retinoblastoma protein.
1741406 1992 A human Id-like helix-loop-helix protein expressed during early development.