Property Summary

NCBI Gene PubMed Count 60
PubMed Score 143.51
PubTator Score 65.46

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (39)

PMID Text
26560438 The ICOS and ICOSL SNPs examined do not have an apparent effect on the disease susceptibility and prognosis of autoimmune thyroid diseases.
25769613 ICOS-ICOS-L interaction promoted cytokine production and survival in type 2 innate lymphoid cells through STAT5 signaling in asthma.
25406581 Loss-of-function mutations in NIK cause impaired ICOSL expression.
24837102 a critical role is described for the rs7282490 ICOSLG region polymorphism associated with immune-mediated diseases in amplifying pattern-recognition receptor initiated inflammatory signaling and cytokine secretion
24729612 the B7h-ICOS interaction may modulate the spread of cancer metastases
24661627 Our data show that mDCs from patients with AR display impaired expression of ICOSL, and this defect licenses mDCs to promote aberrant IL-13- and IL-5-producing Th2 cell responses.
23688438 Findings suggest that the single nucleotide polymorphism (snp) rs4819388 in B7-H2 3'-UTR, through disrupting the regulatory role of miR-24 on B7-H2 expression, contributes to the occurrence of gastric cancer.
23196741 These data suggest that rs2294020 SNP of FOXP3 gene and rs378299 SNP of ICOSLG gene are associated with alopecia areata and with a reduced expression of the FOXP3 and ICOSLG genes in alopecia patients.
23026134 Results highlight an important relationship between Treg and pDC in breast tumors, and show that ICOS/ICOS-L interaction is a central event in immunosuppression of tumor-associated memory CD4(+) T cells.
23024058 ICOSL-expressing macrophages and mRNA levels of ICOSL were increased in the lesional skin of patients with early diffuse cutaneous systemic sclerosis.
22706735 ICOS-ICOSL signaling plays a direct role in proliferation and differentiation of thyroid gland cells and may have important effects on the initiation, maintenance and exaggeration of autoimmune responses in local tissue.
22577174 A model of positive feedback conferred by ICOS-LICOS interaction between TGN1412-treated T cells and endothelial cells.
21530327 Similar to B7-1 and B7-2, B7-H2 costimulation via CD28 induced survival factor Bcl-xL, downregulated cell cycle inhibitor p27(kip1), and triggered signaling cascade of ERK and AKT kinase-dependent pathways
21098714 Data show that ICOS-L expression by melanoma tumor cells may directly drive Treg activation and expansion in the tumor microenvironment as another mechanism of immune evasion.
21072187 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20217071 Suppressed ICOSLG gene expression is associated with cigarette smoking.
20176734 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19760754 Observational study of gene-disease association. (HuGE Navigator)
19737469 Oxidized low density lipoprotein up-regulates the expression of ICOSL in coronary artery endothelial cells.
19726311 B7RP-1 is expressed on the membrane of HCAECs.
19395451 ICOSL:ICOS+ pathway costimulates effector T cells, shaping the Th2 response and regulating humoral immunity.
19347721 role of stimulus by B7 in myeloblastic leukemic
19202444 Genetic variation in this protein affects the outcome and failure of kidney tranplantation.
18587394 Genome-wide association study of gene-disease association. (HuGE Navigator)
18294651 The generated a 3T3 cellular library retrovirally expressing mutants of the murine B7h gene. Screening of this unbiased cellular library identified residues of murine B7h. These residues are located on the same of human B7h by mutagenesis.
17242332 ICOS-L may be relevant in inducing an acute immune response and may be critically involved in perpetuating inflammation in chronically immune-mediated disorders of the peripheral nervous system.
16951355 ICOSL receptor binding site is mediated solely by the immunoglobulin (Ig) variable domain but requires the Ig constant domain for maintaining structural integrity of the protein.
16221208 Interaction of tubular epithelial cells and kidney infiltrating T cells via ICOS-L and B7-H1 may change the balance of positive and negative signals to the T cells
16115907 Results indicate the expression of functional B7-H2 molecule may facilitate progression of acute myeloid leukemia.
15131796 B7h-ICOS protein costimulatory pathway may be important in intestinal epithelial cell(iec):T-cell interactions. IEC expressed B7h and B7-H1.
15047568 Expression of B7-H3 by nasal epithelial. Expands range of potential costimulatory signals through which these cells may interact with activated mucosal T lymphocytes. Extent of mucociliary differentiation of cultured cells may influence this capability.
14603470 ICOSL protein and mRNA was expressed in 7 of 12 glioma cell lines and expression is upregulated by the inflammatory cytokine, tumor necrosis factor-alpha (TNF-alpha), whereas interferon-gamma (IFN-gamma) has no such effect
12960306 A critical role of the B7-like protein-ICOS costimulatory pathway is demonstrated in the pathogenesis of lupus nephritis.
12800259 ICOS-B7H costimulatory pathway may be involved in the negative regulation of cell-mediated immune responses.
12707012 These results demonstrate that airway epithelial cells express the costimulatory molecule B7-H2, and suggest the possibility that B7-H2 may participate in antigen presentation by epithelial cells.
12456022 ICOS-L is a ligand for ICOS and plays an important functional role in the activation of memory T cells by endothelial cells [review]

AA Sequence

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQN      1 - 70
SSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSV     71 - 140
PVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPS    141 - 210
VNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDR    211 - 280
CLQHSYAGAWAVSPETELTGHV                                                    281 - 302
//

Text Mined References (61)

PMID Year Title
26560438 2016 Association of polymorphisms in the ICOS and ICOSL genes with the pathogenesis of autoimmune thyroid diseases.
25769613 2015 ICOS:ICOS-ligand interaction is required for type 2 innate lymphoid cell function, homeostasis, and induction of airway hyperreactivity.
25406581 2014 Biallelic loss-of-function mutation in NIK causes a primary immunodeficiency with multifaceted aberrant lymphoid immunity.
24837102 2014 Pattern recognition receptor signaling in human dendritic cells is enhanced by ICOS ligand and modulated by the Crohn's disease ICOSLG risk allele.
24729612 2014 B7h triggering inhibits the migration of tumor cell lines.
24661627 2014 Impaired ICOSL in human myeloid dendritic cells promotes Th2 responses in patients with allergic rhinitis and asthma.
23688438 2013 A functional variant at miR-24 binding site in B7-H2 alters susceptibility to gastric cancer in a Chinese Han population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23196741 2014 Single nucleotide polymorphisms in the promoter regions of Foxp3 and ICOSLG genes are associated with Alopecia areata.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23026134 2012 ICOS-ligand expression on plasmacytoid dendritic cells supports breast cancer progression by promoting the accumulation of immunosuppressive CD4+ T cells.
23024058 2013 Augmented ICOS expression in patients with early diffuse cutaneous systemic sclerosis.
22706735 2012 Involvement of inducible costimulator ligand (ICOSL) expression in thyroid tissue in hyperthyroidism of Graves' disease patients.
22577174 2012 ICOS-LICOS interaction is critically involved in TGN1412-mediated T-cell activation.
21530327 2011 B7-h2 is a costimulatory ligand for CD28 in human.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21098714 2010 Melanoma cells express ICOS ligand to promote the activation and expansion of T-regulatory cells.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20217071 2010 Impact of female cigarette smoking on circulating B cells in vivo: the suppressed ICOSLG, TCF3, and VCAM1 gene functional network may inhibit normal cell function.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.
20176734 2010 Comparative genetic analysis of inflammatory bowel disease and type 1 diabetes implicates multiple loci with opposite effects.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19760754 2010 Analysis of 39 Crohn's disease risk loci in Swedish inflammatory bowel disease patients.
19737469 2009 [Expression of ICOSL on human coronary artery endothelial cells and its being interferentialed by ox-LDL].
19726311 2009 [Expression of B7-related protein-1 on human coronary artery endothelial cells and its clinical significance].
19395451 2009 Increased expression of soluble inducible costimulator ligand (ICOSL) in patients with systemic lupus erythematosus.
19347721 2009 Dual attack on myeloblastic leukemic cells: the stimulus by B7 molecules matters.
19202444 2009 Association of genetic variation in inducible costimulator gene with outcome of kidney transplantation.
18587394 2008 Genome-wide association defines more than 30 distinct susceptibility loci for Crohn's disease.
18294651 2008 Mapping of the ICOS binding surface of murine B7h using an unbiased, cellular library of B7h mutants created by cyclical packaging rescue.
17242332 2007 Expression of CD28-related costimulatory molecule and its ligand in inflammatory neuropathies.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16951355 2006 Structural basis of inducible costimulator ligand costimulatory function: determination of the cell surface oligomeric state and functional mapping of the receptor binding site of the protein.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16221208 2005 Renal tubular epithelial cells modulate T-cell responses via ICOS-L and B7-H1.
16115907 2005 Expression of functional B7-H2 and B7.2 costimulatory molecules and their prognostic implications in de novo acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15131796 2004 The expression and function of costimulatory molecules B7H and B7-H1 on colonic epithelial cells.
15047568 2004 Expression of genes for B7-H3 and other T cell ligands by nasal epithelial cells during differentiation and activation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14603470 2003 Expression of the B7-related molecule ICOSL by human glioma cells in vitro and in vivo.
12960306 2003 Involvement of inducible costimulator-B7 homologous protein costimulatory pathway in murine lupus nephritis.
12800259 2003 In situ expression and significance of B7 costimulatory molecules within tissues of human gastric carcinoma.
12707012 2003 Expression of the costimulatory molecule B7-H2 (inducible costimulator ligand) by human airway epithelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456022 Inducible costimulator-ligand (ICOS-L).
12145647 2002 Antigen-specific regulatory T cells develop via the ICOS-ICOS-ligand pathway and inhibit allergen-induced airway hyperreactivity.
11983910 2002 ICOS-ligand, expressed on human endothelial cells, costimulates Th1 and Th2 cytokine secretion by memory CD4+ T cells.
11956294 2002 Ligand binding sites of inducible costimulator and high avidity mutants with improved function.
11429535 2001 ICOS costimulation: It's not just for TH2 cells anymore.
11390480 2001 Differential expression of inducible costimulator-ligand splice variants: lymphoid regulation of mouse GL50-B and human GL50 molecules.
11023515 2000 Costimulation of T cells by B7-H2, a B7-like molecule that binds ICOS.
11007762 2000 Characterization of a new human B7-related protein: B7RP-1 is the ligand to the co-stimulatory protein ICOS.
10830953 2000 The DNA sequence of human chromosome 21.
10779774 2000 Characterization of human inducible costimulator ligand expression and function.
10657606 2000 Cutting edge: identification of GL50, a novel B7-like protein that functionally binds to ICOS receptor.
9734811 1998 Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.