Property Summary

Ligand Count 72
NCBI Gene PubMed Count 23
PubMed Score 148.96
PubTator Score 67.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Becker muscular dystrophy 1.289 7.4e-07
intraductal papillary-mucinous neoplasm ... 1.300 7.5e-03
limb girdle muscular dystrophy 2B 1.153 2.5e-05
lung adenocarcinoma 1.100 2.6e-06
lung cancer 1.200 3.2e-02
malignant mesothelioma -3.900 4.9e-09
osteosarcoma -2.402 1.3e-09
ovarian cancer 1.200 1.0e-03
psoriasis -2.400 1.7e-05

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (15)

AA Sequence

MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYRPPRYQIAIRA      1 - 70
CFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSW     71 - 140
LEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH    141 - 210
PSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGV    211 - 280
KVDL                                                                      281 - 284
//

Text Mined References (24)

PMID Year Title