Property Summary

NCBI Gene PubMed Count 21
PubMed Score 139.81
PubTator Score 67.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.900 4.9e-09
psoriasis -2.400 1.7e-05
osteosarcoma -2.402 1.3e-09
limb girdle muscular dystrophy 2B 1.153 2.5e-05
Becker muscular dystrophy 1.289 7.4e-07
intraductal papillary-mucinous neoplasm ... 1.300 7.5e-03
lung cancer 1.200 3.2e-02
lung adenocarcinoma 1.100 2.6e-06
ovarian cancer 1.200 1.0e-03

Synonym

Accession O60725 Q6FHT0
Symbols PCMT
PPMT
PCCMT
HSTE14
MST098
MSTP098

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (5)

Gene RIF (13)

PMID Text
26706195 simultaneous inhibition of BCR-ABL1 and Icmt may represent a potential therapeutic strategy for CML.
25151967 impact of Icmt on tumorigenic processes
24216479 Silencing ICMT in osteosarcoma cells decreased Notch1 signaling in response to stimulation with cell-surface ligands.
20798596 a role for isoprenylcysteine carboxylmethyltransferase in cell migration and adhesion.
19841875 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19651782 Inhibition of isoprenylcysteine carboxylmethyltransferase (Icmt) decreases activation of RhoA and Rac1, and in the absence of Icmt activity, addition of exogenous RhoA or Rac1 partially rescues directed and random migration, respectively.
19161160 Observational study of gene-disease association. (HuGE Navigator)
19158273 Icmt traverses the Eendoplasmic reticulum membrane eight times, with both N and C termini disposed toward the cytosol and with a helix-turn-helix structure comprising transmembrane (TM) segments 7 and 8.
17347446 ICMT inhibition induces endothelial cell apoptosis through GRP94
14966563 These studies identify isoprenylcysteine carboxyl methyltransferase as a potential target for reducing the growth of K-Ras- and B-Raf-induced malignancies.
12631708 findings suggest that inhibition of isoprenylcysteine-O-carboxyl methyltransferase (ICMT) causes endothelial cell apoptosis by attenuation of Ras GTPase methylation and activation and its downstream antiapoptotic signaling pathway.
12006387 ICMTase is a critical component of the redox-sensitive VCAM-1-selective signaling pathway and appears to activate a discrete inflammatory signaling pathway, at least in part, through the methylation of Rac1 in endothelial cells.
11906819 modulation of pcCMT activity in retinoic acid (RA)-treated SH-SY5Y neuroblastoma cells

AA Sequence

MAGCAARAPPGSEARLSLATFLLGASVLALPLLTRAGLQGRTGLALYVAGLNALLLLLYRPPRYQIAIRA      1 - 70
CFLGFVFGCGTLLSFSQSSWSHFGWYMCSLSLFHYSEYLVTAVNNPKSLSLDSFLLNHSLEYTVAALSSW     71 - 140
LEFTLENIFWPELKQITWLSVTGLLMVVFGECLRKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH    141 - 210
PSYVGWFYWSIGTQVMLCNPICGVSYALTVWRFFRDRTEEEEISLIHFFGEEYLEYKKRVPTGLPFIKGV    211 - 280
KVDL                                                                      281 - 284
//

Text Mined References (22)

PMID Year Title
26706195 2016 Inhibition of isoprenylcysteine carboxylmethyltransferase augments BCR-ABL1 tyrosine kinase inhibition-induced apoptosis in chronic myeloid leukemia.
25151967 2015 Isoprenylcysteine carboxylmethyltransferase regulates mitochondrial respiration and cancer cell metabolism.
24216479 2013 Isoprenylcysteine carboxylmethyltransferase deficiency exacerbates KRAS-driven pancreatic neoplasia via Notch suppression.
20798596 RHO methylation matters: a role for isoprenylcysteine carboxylmethyltransferase in cell migration and adhesion.
19841875 2010 Polymorphisms of the lamina maturation pathway and their association with the metabolic syndrome: the DESIR prospective study.
19651782 2009 Role of isoprenylcysteine carboxylmethyltransferase-catalyzed methylation in Rho function and migration.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19158273 2009 Topology of mammalian isoprenylcysteine carboxyl methyltransferase determined in live cells with a fluorescent probe.
17347446 2007 Inhibition of ICMT induces endothelial cell apoptosis through GRP94.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14966563 2004 Inactivation of Icmt inhibits transformation by oncogenic K-Ras and B-Raf.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12750467 2003 Targeting Ras signaling through inhibition of carboxyl methylation: an unexpected property of methotrexate.
12631708 2003 Isoprenylcysteine carboxyl methyltransferase activity modulates endothelial cell apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12006387 2002 Role of isoprenylcysteine carboxyl methyltransferase in tumor necrosis factor-alpha stimulation of expression of vascular cell adhesion molecule-1 in endothelial cells.
10649571 2000 Polyglutamine expansion down-regulates specific neuronal genes before pathologic changes in SCA1.
10441503 1999 The carboxyl methyltransferase modifying G proteins is a metalloenzyme.
10412982 1999 Endomembrane trafficking of ras: the CAAX motif targets proteins to the ER and Golgi.
9614111 1998 Mammalian prenylcysteine carboxyl methyltransferase is in the endoplasmic reticulum.