Property Summary

Ligand Count 4
NCBI Gene PubMed Count 23
PubMed Score 422.24
PubTator Score 40.47

Knowledge Summary

Patent (28,243)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Endocrine-Cerebroosteodysplasia 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
endocrine-cerebro-osteodysplasia syndrome 1 5.956 3.0
Asthma 385 3.019 1.5

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.600 2.8e-05
group 4 medulloblastoma 1.700 1.4e-04
intraductal papillary-mucinous adenoma (... 1.300 1.3e-03
intraductal papillary-mucinous carcinoma... 1.500 4.8e-03
lung cancer 1.700 2.7e-03
malignant mesothelioma -1.800 4.6e-07
osteosarcoma -1.093 1.2e-02
psoriasis -1.900 4.6e-05

Gene RIF (13)

AA Sequence

MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIR      1 - 70
ENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVK     71 - 140
IADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIF    141 - 210
KICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALR    211 - 280
YPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYP    281 - 350
YKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWAD    351 - 420
LDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYL    421 - 490
KHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFL    491 - 560
KKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYAS    561 - 630
RR                                                                        631 - 632
//

Text Mined References (27)

PMID Year Title