Property Summary

NCBI Gene PubMed Count 32
PubMed Score 64.89
PubTator Score 55.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytoma -2.000 7.3e-27
ependymoma -2.200 1.0e-11
oligodendroglioma -2.000 1.2e-23
glioblastoma -2.600 6.4e-06
medulloblastoma -2.300 4.4e-05
atypical teratoid / rhabdoid tumor -2.300 4.8e-07
medulloblastoma, large-cell -2.500 1.1e-03
primitive neuroectodermal tumor -2.400 5.7e-04
adult high grade glioma -2.300 1.1e-03
pilocytic astrocytoma -2.200 1.3e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (17)

PMID Text
23079714 ICAM5 V301I and rs281439 variants may contribute to the susceptibility of breast cancer. [Meta-analysis]
22781129 A specific microenvironment facilitating ARF6-mediated mobilization of TLN that contributes to promotion of dendritic spine development.
20644561 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
18223167 ICAM-5 is involved in immune privilege of the brain and acts as an anti-inflammatory agent.
17293864 Observational study of gene-disease association. (HuGE Navigator)
16733712 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16434609 study does not confirm association between ICAM 5 V3001 polymorphism and breast cancer risk

AA Sequence

MPGPSPGLRRALLGLWAALGLGLFGLSAVSQEPFWADLQPRVAFVERGGSLWLNCSTNCPRPERGGLETS      1 - 70
LRRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPDRVELMPLPPWQPVGENFTL     71 - 140
SCRVPGAGPRASLTLTLLRGAQELIRRSFAGEPPRARGAVLTATVLARREDHGANFSCRAELDLRPHGLG    141 - 210
LFENSSAPRELRTFSLSPDAPRLAAPRLLEVGSERPVSCTLDGLFPASEARVYLALGDQNLSPDVTLEGD    211 - 280
AFVATATATASAEQEGARQLVCNVTLGGENRETRENVTIYSFPAPLLTLSEPSVSEGQMVTVTCAAGAQA    281 - 350
LVTLEGVPAAVPGQPAQLQLNATENDDRRSFFCDATLDVDGETLIKNRSAELRVLYAPRLDDSDCPRSWT    351 - 420
WPEGPEQTLRCEARGNPEPSVHCARSDGGAVLALGLLGPVTRALSGTYRCKAANDQGEAVKDVTLTVEYA    421 - 490
PALDSVGCPERITWLEGTEASLSCVAHGVPPPDVICVRSGELGAVIEGLLRVAREHAGTYRCEATNPRGS    491 - 560
AAKNVAVTVEYGPRFEEPSCPSNWTWVEGSGRLFSCEVDGKPQPSVKCVGSGGATEGVLLPLAPPDPSPR    561 - 630
APRIPRVLAPGIYVCNATNRHGSVAKTVVVSAESPPEMDESTCPSHQTWLEGAEASALACAARGRPSPGV    631 - 700
RCSREGIPWPEQQRVSREDAGTYHCVATNAHGTDSRTVTVGVEYRPVVAELAASPPGGVRPGGNFTLTCR    701 - 770
AEAWPPAQISWRAPPGALNIGLSSNNSTLSVAGAMGSHGGEYECAATNAHGRHARRITVRVAGPWLWVAV    771 - 840
GGAAGGAALLAAGAGLAFYVQSTACKKGEYNVQEAESSGEAVCLNGAGGGAGGAAGAEGGPEAAGGAAES    841 - 910
PAEGEVFAIQLTSA                                                            911 - 924
//

Text Mined References (35)

PMID Year Title
23079714 2013 The genetic polymorphisms of intercellular cell adhesion molecules and breast cancer susceptibility: a meta-analysis.
22781129 2012 ARF6-mediated endosomal transport of Telencephalin affects dendritic filopodia-to-spine maturation.
20644561 2011 A large-scale candidate gene approach identifies SNPs in SOD2 and IL13 as predictive markers of response to preoperative chemoradiation in rectal cancer.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18691975 2008 An unusual allosteric mobility of the C-terminal helix of a high-affinity alphaL integrin I domain variant bound to ICAM-5.
18223167 2008 Shedded neuronal ICAM-5 suppresses T-cell activation.
17293864 2007 A common coding variant in CASP8 is associated with breast cancer risk.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16820411 2006 alpha-Actinin-dependent cytoskeletal anchorage is important for ICAM-5-mediated neuritic outgrowth.
16733712 2006 ICAM gene cluster SNPs and prostate cancer risk in African Americans.
16434609 2006 Polymorphisms in the ICAM gene locus are not associated with breast cancer Risk.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11719200 2001 Interaction with telencephalin and the amyloid precursor protein predicts a ring structure for presenilins.
10893271 2000 Intercellular adhesion molecule-5 induces dendritic outgrowth by homophilic adhesion.
10741396 2000 Binding of T lymphocytes to hippocampal neurons through ICAM-5 (telencephalin) and characterization of its interaction with the leukocyte integrin CD11a/CD18.
10592287 1999 Neuronal adhesion molecule telencephalin induces rapid cell spreading of microglia.
10402269 1999 Development of telencephalin in the human cerebrum.
9828136 1998 Mapping of the ICAM-5 (telencephalin) gene, a neuronal member of the ICAM family, to a location between ICAM-1 and ICAM-3 on human chromosome 19p13.2.
9717930 1998 Telencephalin as an indicator for temporal-lobe dysfunction.
9638475 1998 The intercellular adhesion molecule (ICAM) family of proteins. New members and novel functions.
9556028 1998 Polarized distribution and cell type-specific localization of telencephalin, an intercellular adhesion molecule.
8995416 1997 cDNA cloning and chromosomal localization of the human telencephalin and its distinctive interaction with lymphocyte function-associated antigen-1.
7724062 1994 Telencephalin: a neuronal area code molecule?