Property Summary

NCBI Gene PubMed Count 44
PubMed Score 28.14
PubTator Score 34.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (29)

AA Sequence

MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS      1 - 70
NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILE     71 - 140
PPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVIC    141 - 210
HARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA             211 - 271
//

Text Mined References (45)

PMID Year Title