Property Summary

NCBI Gene PubMed Count 43
PubMed Score 27.06
PubTator Score 34.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 2.300 6.1e-06
osteosarcoma -3.880 2.6e-09
non-small cell lung cancer -2.371 4.4e-15
lung cancer -3.100 5.9e-06
invasive ductal carcinoma -1.875 2.7e-02
ovarian cancer -1.200 2.1e-06

Gene RIF (28)

PMID Text
26137540 Cytometry analysis evidenced a specific expression profile on reticulocytes of SCA infants, with notably an increased expression of the adhesion molecules Lu/BCAM, ICAM-4 and LFA-3, both in percentage of positive cells and in surface density.
25586702 ICAM-1 and ICAM-4 play roles in host cell invasion by M. tuberculosis and P. falciparum, respectively.
24673173 Seven variant ICAM4 alleles were found, distinct from the wild-type ICAM4 allele (GenBank KF712272), known as LW*05 and encoding LW(a) .
23417980 Data from differentiating cultured erythroid precursor cells suggest that RhAG (Rh-associated glycoprotein) knockdown abolishes Rh blood group expression (ICAM4; RhoD [ras homolog family member D]; CD47 Rh-related antigen) in erythroid cells.
22147898 Erythrocyte plasma membrane-bound ERK1/2 activation promotes ICAM-4-mediated sickle red cell adhesion to endothelium.
22082156 Knockdown of intercellular adhesion molecule 4 (ICAM4) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20622166 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20015873 In a transgenic mouse model of sickle cell disease ICAM-4 is implicated in abnormal adhesiveness of erythrocytes to endothelium.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
18549656 LWa allele occurs with incidence of 100% of donors in this study, while LWb allele has not been found in Chinese population.
17609430 LW play potentially pathophysiological roles in sickle cell disease
16985175 We show that ICAM-4 functions as a ligand for the monocyte/macrophage-specific CD11c/CD18. Deletion of the individual immunoglobulin domains of ICAM-4 demonstrated that both its domains contain binding sites for CD11c/CD18.
16564726 Review. LW antigen contributes to RBC adhesion, thrombosis, and (in sickle cell disease) vaso-occlusion.
15847654 Observational study of genetic testing. (HuGE Navigator)
15355350 Different integrins bind to different but partly overlapping sites on ICAM4, and ICAM4 may accommodate multiple integrin receptors present on leukocytes, platelets and endothelial cells.
15308566 LW on sickle but not on normal erythrocytes undergoes increased PKA-dependent serine phosphorylation as a result of activation. The major counter receptor for LW was identified as the alphavbeta3 integrin on ECs
14551135 12 single amino-acid changes in ICAM4 affected the interaction of ICAM-4 with alpha(V) integrins
12694184 binds to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins
12477717 ICAM-4 as the first red blood cells protein ligand of platelets that may have relevant physiological significance

AA Sequence

MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCS      1 - 70
NSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYKPPHSVILE     71 - 140
PPVLKGRKYTLRCHVTQVFPVGYLVVTLRHGSRVIYSESLERFTGLDLANVTLTYEFAAGPRDFWQPVIC    141 - 210
HARLNLDGLVVRNSSAPITLMLAWSPAPTALASGSIAALVGILLTVGAAYLCKCLAMKSQA             211 - 271
//

Text Mined References (44)

PMID Year Title
26137540 2015 Erythroid Adhesion Molecules in Sickle Cell Anaemia Infants: Insights Into Early Pathophysiology.
25586702 2015 Host ICAMs play a role in cell invasion by Mycobacterium tuberculosis and Plasmodium falciparum.
25416956 2014 A proteome-scale map of the human interactome network.
24673173 2014 Genetic variation of the whole ICAM4 gene in Caucasians and African Americans.
23417980 2013 In vitro generated Rh(null) red cells recapitulate the in vivo deficiency: a model for rare blood group phenotypes and erythroid membrane disorders.
22147898 2012 Erythrocyte plasma membrane-bound ERK1/2 activation promotes ICAM-4-mediated sickle red cell adhesion to endothelium.
21533024 2011 Genome-wide association analysis of soluble ICAM-1 concentration reveals novel associations at the NFKBIK, PNPLA3, RELA, and SH2B3 loci.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20622166 2010 Combined effect of inflammatory gene polymorphisms and the risk of ischemic stroke in a prospective cohort of subjects with type 2 diabetes: a Go-DARTS study.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20167578 2010 Large-scale genomic studies reveal central role of ABO in sP-selectin and sICAM-1 levels.
20015873 2010 Intercellular adhesion molecule-4 and CD36 are implicated in the abnormal adhesiveness of sickle cell SAD mouse erythrocytes to endothelium.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
18604267 2008 Novel association of ABO histo-blood group antigen with soluble ICAM-1: results of a genome-wide association study of 6,578 women.
18549656 2008 [Polymorphism of LW blood group gene in Chinese population].
17609430 2007 Epinephrine-induced activation of LW-mediated sickle cell adhesion and vaso-occlusion in vivo.
16985175 2007 Red-cell ICAM-4 is a ligand for the monocyte/macrophage integrin CD11c/CD18: characterization of the binding sites on ICAM-4.
16564726 LW protein: a promiscuous integrin receptor activated by adrenergic signaling.
15847654 2005 A flexible array format for large-scale, rapid blood group DNA typing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355350 2004 Integrin receptor specificity for human red cell ICAM-4 ligand. Critical residues for alphaIIbeta3 binding.
15308566 2004 Epinephrine acts through erythroid signaling pathways to activate sickle cell adhesion to endothelium via LW-alphavbeta3 interactions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14551135 2004 Identification of critical amino-acid residues on the erythroid intercellular adhesion molecule-4 (ICAM-4) mediating adhesion to alpha V integrins.
12694184 2003 Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477717 2003 Red cell ICAM-4 is a novel ligand for platelet-activated alpha IIbbeta 3 integrin.
11857637 2002 Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.
11435317 2001 Intercellular adhesion molecule-4 binds alpha(4)beta(1) and alpha(V)-family integrins through novel integrin-binding mechanisms.
10846180 2000 Binding sites of leukocyte beta 2 integrins (LFA-1, Mac-1) on the human ICAM-4/LW blood group protein.
9638475 1998 The intercellular adhesion molecule (ICAM) family of proteins. New members and novel functions.
8639917 1996 Characterization of the gene encoding the human LW blood group protein in LW+ and LW- phenotypes.
8566017 1995 The red cell LW blood group protein is an intercellular adhesion molecule which binds to CD11/CD18 leukocyte integrins.
8563755 1996 Candidate gene acting as a suppressor of the RH locus in most cases of Rh-deficiency.
8202485 1994 The LW blood group glycoprotein is homologous to intercellular adhesion molecules.
7632968 1995 Molecular basis and expression of the LWa/LWb blood group polymorphism.
6431896 1984 Linkage of the LW blood group locus with the complement C3 and Lutheran blood group loci.