Property Summary

NCBI Gene PubMed Count 77
PubMed Score 393.70
PubTator Score 144.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.387 1.1e-03
malignant mesothelioma -1.200 1.5e-05
cutaneous lupus erythematosus 1.100 4.8e-02
osteosarcoma -3.806 2.3e-06
periodontitis 1.300 5.4e-24
lung cancer -1.500 8.9e-05
interstitial cystitis 1.700 2.6e-03
lung carcinoma -2.100 3.1e-25
ovarian cancer 1.900 5.7e-06

Protein-protein Interaction (5)

Gene RIF (43)

PMID Text
24474251 with larger patient groups and preferably detailed histopathological and clinical evaluations, are needed to explain the severity of ICAM-1, ICAM-2, and ICAM-3 molecules in Barrett's esophagus
24177012 this data clearly indicate that ICAM-3 promotes drug resistance via inhibition of apoptosis.
23775590 ICAM3 acts as recognition receptors in the phagocytosis portals of macrophages for engulfment of apoptotic neutrophils.
23144795 Intercellular adhesion molecule (ICAM)-3 mRNA is upregulated in non-adherent endothelial forming cells.
22479382 Results indicate that the ICAM-3 gene promoter is negatively regulated by RUNX3.
22396536 analysis of activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and beta2 integrins
22205703 the molecular basis of allergen-induced Th2 cell polarization
22117198 ICAM-3 may be an important adhesion molecule involved in chemotaxis to apoptotic human leukocytes.
21712539 the cross-talk between neutrophils and NK cells is mediated by ICAM-3 and CD11d/CD18, respectively.
21381019 induction of morphological polarization in primary T lymphocytes and Jurkat cells enhances Kidins220/ARMS colocalization with ICAM-3
21239057 Single nucleotide polymorphisms in ICAM3 gene is associated with lymphoma.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20086017 CCR1 antagonist, BX471, did not significantly alter ICAM-3 expression in relapsing-remitting multiple sclerosis patients.
19956847 ICAM-3 enhances the migratory and invasive potential of human non-small cell lung cancer cells by inducing MMP-2 and MMP-9 via Akt and CREB
19913121 Observational study of gene-disease association. (HuGE Navigator)
19898481 Observational study of gene-disease association. (HuGE Navigator)
19801714 no significant risk association was found for SARS infection for the ICAM-3 Asp143Gly SNP.
19801714 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19225705 Lower expression of ICAM-3 and higher expression of ICAM-1 suggest that AMs may be involved in the pathogenesis of scleroderma.
18354203 extended alpha(L)beta(2) with an open headpiece is required for ICAM-3 adhesion
18261116 This is the first case of CD20 positive mycosis fungoides involving a lymph node to be reported in the literature.
17913807 Here we demonstrate that leukocyte function-associated antigen 1 (LFA-1), intercellular adhesion molecule 1 (ICAM-1), and ICAM-3 are enriched at the VS and that inhibition of these interactions influences conjugate formation and reduces VS assembly.
17591777 talin induced an intermediate affinity alphaLbeta2 that adhered constitutively to its ligand intercellular adhesion molecule ICAM-1 but not ICAM-3.
17570115 Observational study of gene-disease association. (HuGE Navigator)
17570115 Patients with SARS homozygous for ICAM3 Gly143 showed significant association with higher lactate dehydrogenase levels and lower total white blood cell counts.
17452477 AM3 inhibits the interaction of DC-SIGN with ICAM3 and HIV-1 gp120 protein and blocks the DC-SIGN-dependent capture of HIV virions and the HIV trans-infection capability of DC-SIGN transfectants
17145745 The results suggest that ICAM-3 assists in the interaction of granulocytes with DC-SIGN of dendritic cells.
15958383 the hybrid domain of integrin alphaL beta2 has different requirements of affinity states for ICAM-1 and ICAM-3 binding
15880373 Expression of ICAM-3 can be used as a valuable biomarker to predict the radiation resistance in cervical cancer that occurs during radiotherapy.
15163761 acts as a costimulating molecule to increase HIV-1 transcription and viral replication, a process allowing productive infection of quiescent CD4+ T lymphocytes.
14970226 soluble DC-SIGN bound to gp120-Fc more than 100- and 50-fold better than ICAM-2-Fc and ICAM-3-Fc, respectively. Binding sites are described.
14726630 ICAM-3 is expressed on human bone marrow endothelial cells and controls endothelial integrity via reactive oxygen species-dependent signaling.
14704632 Relationship of intercellular adhesion molecule-3 and hepatocyte growth factor with amyloidosis A in chronic renal-failure patients. There was a higher density of intercellular adhesion molecule-3-positive cells in the patients with amyloidosis A.
12743567 ICAM-3 is highly expressed on the surface of human eosinophils and has a role in the downregulation of GM-CSF production.
12600815 the expression of ICAM-1 might involve both p38 MAPK and NF-kappaB activities, whereas the regulation of CD11b, CD18, and ICAM-3 expressions might be mediated through p38 MAPK but not NF-kappaB.
12571844 Expression of DC-SIGN and its ligand, ICAM-3, is found in substantial amounts only in RA synovium, suggesting that their interaction is implicated in the additional activation of synovial macrophages that leads to the production of EMMPRIN and MMP-1.
12021323 interactions with DC-SIGN does not promote DC-SIGN mediated HIV-1 transmission
11799126 identification of DC-SIGN binding sites
11784723 A novel serine-rich motif in the intercellular adhesion molecule 3 is critical for its ezrin/radixin/moesin-directed subcellular targeting

AA Sequence

MATMVPSVLWPRACWTLLVCCLLTPGVQGQEFLLRVEPQNPVLSAGGSLFVNCSTDCPSSEKIALETSLS      1 - 70
KELVASGMGWAAFNLSNVTGNSRILCSVYCNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQ     71 - 140
VEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQGLGLFVNTSAP    141 - 210
RQLRTFVLPVTPPRLVAPRFLEVETSWPVDCTLDGLFPASEAQVYLALGDQMLNATVMNHGDTLTATATA    211 - 280
TARADQEGAREIVCNVTLGGERREARENLTVFSFLGPIVNLSEPTAHEGSTVTVSCMAGARVQVTLDGVP    281 - 350
AAAPGQPAQLQLNATESDDGRSFFCSATLEVDGEFLHRNSSVQLRVLYGPKIDRATCPQHLKWKDKTRHV    351 - 420
LQCQARGNPYPELRCLKEGSSREVPVGIPFFVNVTHNGTYQCQASSSRGKYTLVVVMDIEAGSSHFVPVF    421 - 490
VAVLLTLGVVTIVLALMYVFREHQRSGSYHVREESTYLPLTSMQPTEAMGEEPSRAE                 491 - 547
//

Text Mined References (83)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24474251 2014 Investigation of intercellular adhesion molecules (ICAMs) gene expressions in patients with Barrett's esophagus.
24177012 2013 ICAM-3 endows anticancer drug resistance against microtubule-damaging agents via activation of the ICAM-3-AKT/ERK-CREB-2 pathway and blockage of apoptosis.
23775590 2013 Novel role of ICAM3 and LFA-1 in the clearance of apoptotic neutrophils by human macrophages.
23144795 2012 Characterization of a distinct population of circulating human non-adherent endothelial forming cells and their recruitment via intercellular adhesion molecule-3.
22479382 2012 RUNX3 regulates intercellular adhesion molecule 3 (ICAM-3) expression during macrophage differentiation and monocyte extravasation.
22396536 2012 Activated apoptotic cells induce dendritic cell maturation via engagement of Toll-like receptor 4 (TLR4), dendritic cell-specific intercellular adhesion molecule 3 (ICAM-3)-grabbing nonintegrin (DC-SIGN), and ?2 integrins.
22205703 2012 Retagging identifies dendritic cell-specific intercellular adhesion molecule-3 (ICAM3)-grabbing non-integrin (DC-SIGN) protein as a novel receptor for a major allergen from house dust mite.
22117198 2012 Apoptotic cell-derived ICAM-3 promotes both macrophage chemoattraction to and tethering of apoptotic cells.
21712539 2011 On the potential involvement of CD11d in co-stimulating the production of interferon-? by natural killer cells upon interaction with neutrophils via intercellular adhesion molecule-3.
21381019 2011 The neuronal protein Kidins220/ARMS associates with ICAM-3 and other uropod components and regulates T-cell motility.
21269460 2011 Initial characterization of the human central proteome.
21239057 2011 Polymorphisms in integrin genes and lymphoma risk.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20086017 2010 No significant effect of orally administered chemokine receptor 1 antagonist on intercellular adhesion molecule-3 expression in relapsing--remitting multiple sclerosis patients.
19956847 2010 ICAM-3 enhances the migratory and invasive potential of human non-small cell lung cancer cells by inducing MMP-2 and MMP-9 via Akt and CREB.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19898481 2009 Genetic variants at CD28, PRDM1 and CD2/CD58 are associated with rheumatoid arthritis risk.
19801714 2009 Functional role of ICAM-3 polymorphism in genetic susceptibility to SARS infection.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19225705 2009 Altered adhesion molecules expression on peripheral blood mononuclear cells from patients with systemic sclerosis and clinical correlations.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18354203 2008 Intercellular adhesion molecule-3 binding of integrin alphaL beta2 requires both extension and opening of the integrin headpiece.
18261116 2008 CD20 positive mycosis fungoides: a case report.
17913807 2007 Adhesion molecule interactions facilitate human immunodeficiency virus type 1-induced virological synapse formation between T cells.
17591777 2007 The cytosolic protein talin induces an intermediate affinity integrin alphaLbeta2.
17570115 2007 Association of ICAM3 genetic variant with severe acute respiratory syndrome.
17145745 2007 DC-SIGN binds ICAM-3 isolated from peripheral human leukocytes through Lewis x residues.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
15958383 2005 Epitope mapping of monoclonal antibody to integrin alphaL beta2 hybrid domain suggests different requirements of affinity states for intercellular adhesion molecules (ICAM)-1 and ICAM-3 binding.
15880373 2005 Increased expression of ICAM-3 is associated with radiation resistance in cervical cancer.
15728350 2005 An atomic resolution view of ICAM recognition in a complex between the binding domains of ICAM-3 and integrin alphaLbeta2.
15572059 2005 The potential significance of adaptive evolution and dimerization in chimpanzee intercellular cell adhesion molecules (ICAMs).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15163761 2004 Engagement of ICAM-3 provides a costimulatory signal for human immunodeficiency virus type 1 replication in both activated and quiescent CD4+ T lymphocytes: implications for virus pathogenesis.
14970226 2004 DC-SIGN binds to HIV-1 glycoprotein 120 in a distinct but overlapping fashion compared with ICAM-2 and ICAM-3.
14726630 ICAM-3 activation modulates cell-cell contacts of human bone marrow endothelial cells.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14704632 2004 Relationship of intercellular adhesion molecule-3 and hepatocyte growth factor with amyloidosis A in chronic renal-failure patients.
12743567 2003 Ligation of intercellular adhesion molecule 3 inhibits GM-CSF production by human eosinophils.
12600815 2003 Interleukin-3, -5, and granulocyte macrophage colony-stimulating factor-induced adhesion molecule expression on eosinophils by p38 mitogen-activated protein kinase and nuclear factor-[kappa] B.
12571844 2003 Expression of the dendritic cell-associated C-type lectin DC-SIGN by inflammatory matrix metalloproteinase-producing macrophages in rheumatoid arthritis synovium and interaction with intercellular adhesion molecule 3-positive T cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082081 2002 Dynamic interaction of VCAM-1 and ICAM-1 with moesin and ezrin in a novel endothelial docking structure for adherent leukocytes.
12021323 2002 Functional evaluation of DC-SIGN monoclonal antibodies reveals DC-SIGN interactions with ICAM-3 do not promote human immunodeficiency virus type 1 transmission.
11857637 2002 Inhibition of LFA-1/ICAM-1 and VLA-4/VCAM-1 as a therapeutic approach to inflammation and autoimmune diseases.
11799126 2002 Identification of different binding sites in the dendritic cell-specific receptor DC-SIGN for intercellular adhesion molecule 3 and HIV-1.
11784723 2002 A novel serine-rich motif in the intercellular adhesion molecule 3 is critical for its ezrin/radixin/moesin-directed subcellular targeting.
11353828 2001 Reversibly locking a protein fold in an active conformation with a disulfide bond: integrin alphaL I domains with high affinity and antagonist activity in vivo.
11257134 2001 A dendritic cell-specific intercellular adhesion molecule 3-grabbing nonintegrin (DC-SIGN)-related protein is highly expressed on human liver sinusoidal endothelial cells and promotes HIV-1 infection.
11179968 2001 Structural study of N-linked oligosaccharides of human intercellular adhesion molecule-3 (CD50).
11017109 2000 DC-SIGN-ICAM-2 interaction mediates dendritic cell trafficking.
10721994 2000 Identification of DC-SIGN, a novel dendritic cell-specific ICAM-3 receptor that supports primary immune responses.
10626904 1999 ICAM-3 (CD50) is expressed by human mast cells: induction of homotypic mast cell aggregation via ICAM-3.
10380912 1999 ICAM-3 (CD50) cross-linking augments signaling in CD3-activated peripheral human T lymphocytes.
9661300 1998 Vascular endothelium of human dental pulp expresses diverse adhesion molecules for leukocyte emigration.
9638475 1998 The intercellular adhesion molecule (ICAM) family of proteins. New members and novel functions.
9539703 1998 The structure of the two amino-terminal domains of human ICAM-1 suggests how it functions as a rhinovirus receptor and as an LFA-1 integrin ligand.
9473377 1998 Beta2 integrin/ICAM expression in Crohn's disease.
9298994 1997 Moesin interacts with the cytoplasmic region of intercellular adhesion molecule-3 and is redistributed to the uropod of T lymphocytes during cell polarization.
9268366 1997 Functional mapping of the cytoplasmic region of intercellular adhesion molecule-3 reveals important roles for serine residues.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8777714 1995 A novel leukointegrin, alpha d beta 2, binds preferentially to ICAM-3.
8605703 1996 Soluble forms of P-selectin and intercellular adhesion molecule-3 in synovial fluids.
8459213 1993 Cloning and expression of intercellular adhesion molecule 3 reveals strong homology to other immunoglobulin family counter-receptors for lymphocyte function-associated antigen 1.
8325327 1993 CDw50 and ICAM-3: two names for the same molecule.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7876557 1995 CD50 (ICAM-3) is phosphorylated on tyrosine and is associated with tyrosine kinase activity in human neutrophils.
7851905 1994 The human intercellular adhesion molecule 3 (ICAM3) gene is located in the 19p13.2-p13.3 region, close to the ICAM1 gene.
7836774 1995 Circulating forms of ICAM-3 (cICAM-3). Elevated levels in autoimmune diseases and lack of association with cICAM-1.
7822326 1995 Analysis of the binding site on intercellular adhesion molecule 3 for the leukocyte integrin lymphocyte function-associated antigen 1.
7553659 1995 The role of ICAM expression in immunity and disease.
7523142 1994 Adhesion molecules from the LFA-1/ICAM-1,3 and VLA-4/VCAM-1 pathways on T lymphocytes and vascular endothelium in Graves' and Hashimoto's thyroid glands.
7482494 1995 CD50 (intercellular adhesion molecule-3) is expressed at higher levels on memory than on naive human T cells but induces a similar calcium mobilization on both subsets.
1448174 1992 Cloning and characterization of a new intercellular adhesion molecule ICAM-R.
1448173 1992 Molecular cloning of ICAM-3, a third ligand for LFA-1, constitutively expressed on resting leukocytes.