Property Summary

NCBI Gene PubMed Count 65
PubMed Score 144.70
PubTator Score 117.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
adult high grade glioma -1.600 6.8e-04
atypical teratoid / rhabdoid tumor -1.100 2.4e-05
breast carcinoma -1.300 6.4e-04
dermatomyositis 1.200 1.0e-02
ductal carcinoma in situ -1.200 5.2e-04
ependymoma -1.400 8.1e-08
esophageal adenocarcinoma 1.400 2.4e-02
glioblastoma -1.300 5.5e-03
group 4 medulloblastoma -2.100 5.4e-07
interstitial cystitis 1.100 1.1e-02
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
intraductal papillary-mucinous carcinoma... -1.400 2.3e-03
invasive ductal carcinoma -1.200 3.0e-03
juvenile dermatomyositis 1.371 7.8e-13
lung adenocarcinoma -1.300 4.1e-12
lung cancer -1.100 4.6e-04
lung carcinoma -1.900 5.9e-22
medulloblastoma, large-cell -2.500 3.4e-07
nephrosclerosis 1.490 4.2e-05
non-small cell lung cancer -2.068 6.9e-27
osteosarcoma -1.773 2.7e-04
ovarian cancer 1.100 8.3e-03
periodontitis 1.300 3.0e-32
primitive neuroectodermal tumor -1.100 3.6e-03
psoriasis -1.300 3.4e-04
tuberculosis and treatment for 6 months -1.100 4.0e-03
ulcerative colitis 1.300 6.5e-05

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (31)

AA Sequence

MSSFGYRTLTVALFTLICCPGSDEKVFEVHVRPKKLAVEPKGSLEVNCSTTCNQPEVGGLETSLDKILLD      1 - 70
EQAQWKHYLVSNISHDTVLQCHFTCSGKQESMNSNVSVYQPPRQVILTLQPTLVAVGKSFTIECRVPTVE     71 - 140
PLDSLTLFLFRGNETLHYETFGKAAPAPQEATATFNSTADREDGHRNFSCLAVLDLMSRGGNIFHKHSAP    141 - 210
KMLEIYEPVSDSQMVIIVTVVSVLLSLFVTSVLLCFIFGQHLRQQRMGTYGVRAAWRRLPQAFRP         211 - 275
//

Text Mined References (68)

PMID Year Title