Property Summary

NCBI Gene PubMed Count 976
PubMed Score 8990.11
PubTator Score 5040.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Tear film insufficiency 14
Disease Target Count Z-score Confidence
Atherosclerosis 275 6.366 3.2

Expression

  Differential Expression (25)

Disease log2 FC p
ulcerative colitis 2.500 1.5e-05
urothelial carcinoma -1.500 3.7e-03
malignant mesothelioma -1.800 1.2e-06
cutaneous lupus erythematosus 1.100 6.8e-03
psoriasis -1.600 4.6e-04
posterior fossa group A ependymoma 2.400 2.2e-07
glioblastoma 2.200 8.8e-03
cystic fibrosis 1.284 1.2e-03
atypical teratoid / rhabdoid tumor 1.500 7.4e-03
tuberculosis -1.900 4.2e-04
primary pancreatic ductal adenocarcinoma 2.059 3.1e-03
non-small cell lung cancer -2.215 7.4e-10
lung cancer -6.000 2.5e-07
interstitial cystitis 1.700 2.6e-04
pediatric high grade glioma 1.700 2.7e-03
pilocytic astrocytoma 2.600 3.7e-09
aldosterone-producing adenoma -1.383 2.8e-02
invasive ductal carcinoma -1.663 2.1e-02
nasopharyngeal carcinoma 1.100 1.2e-02
lung carcinoma -3.800 7.1e-24
gastric carcinoma 1.800 1.6e-02
Bipolar Disorder 1.678 2.0e-02
pancreatic cancer 1.900 4.4e-03
head and neck cancer 1.900 1.2e-04
head and neck cancer and chronic obstruc... 1.200 3.2e-03

 GWAS Trait (1)

Gene RIF (1030)

PMID Text
26943967 The genotypic distributions of ICAM-1 (K469E) were significantly different between patients and controls.
26897511 ICAM-1 polymorphism rs1799969 is significantly associated with increased susceptibility to overall cancer.
26872904 BD patients have a lower expression of ICAM-1, VCAM-1, and E-selectin in their tumor tissues. BD-HDL facilitates the adhesion of tumor cells to vascular endothelium by upregulating the expression of ICAM-1 and VCAM-1, thereby promoting the initial progression of breast cancer metastasis
26852488 Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria
26847082 These metastatic tumors revealed no detectable expression of CK8/18, E-cadherin, VCAM-1, and ICAM-1
26841644 Heterogeneity was found in the endothelial cells: their shape, the expression of adhesion molecules(ICAM-1, VCAM-1, and PECAM ), and the adhesion of lymphocytes and monocytes to them changed during the progression of the atherosclerotic process.
26773775 Data suggest that overweight interacts with vitamin D deficiency to modulate inflammatory response, affecting plasma levels of adiponectin, sICAM1 (soluble intercellular adhesion molecule-1), and cytokines (interleukin 6, tumor necrosis factor-alpha).
26751847 These results implying that ICAM-1 might be involved in the progression of breast cancer metastasis and lentivirus-mediated silencing of ICAM-1 might be a potential therapeutic approach for the treatment of breast cancer.
26679764 This study demonstrated that normal levels of sICAM-1 in the early stage, and elevated levels of sICAM-1 in the late stage of schizophrenia.
26648165 The attenuated invasion activity may be associated with the decreased expression of matrix metalloproteinase 9 and intercellular adhesion molecule-1
26634518 Our results also supported the hypothesis that the KK genotype at the K469E locus in ICAM-1 is a risk factor for AIS.
26625754 ICAM-1, VCAM-1 and CD34 are useful biomarkers in evaluation of vascular and inflammatory lesions such as gingival pyogenic granuloma and the results indicate the role of these biomarkers in pathogenesis of oral pyogenic granuloma.
26571024 ICAM1 and CD44 could have a compensation effect on maintaining the stemness characteristics of esophageal squamous cell carcinoma.
26499045 Human bronchial epithelial cells and nasal epithelial cells, on exposure to different strains of influenza virus (H1N1, H3N2, and H9N1) showed significant increase in ICAM-1 gene expression along with the ICAM-1 protein levels (surface and secreted).
26498675 TLR2 S450S and ICAM1 K469E polymorphisms may be associated with polycystic ovary syndrome and metabolic comorbidities in obese women.
26413796 Ultraviolet light-emitting-diode irradiation inhibits TNF-alpha and IFN-gamma-induced expression of ICAM-1 and STAT1 phosphorylation in human keratinocytes.
26397390 ABL-N administration induced apoptosis of PC3 cells in a dose-dependent manner, along with the enhanced activity of caspases and increased Bax/Bcl-2 ratio. Expression of KLF5, Stat5b and ICAM-1 was significantly downregulated in PC3 cells.
26377944 Soluble ICAM1 was higher in ADHD patients than in controls.
26345838 expression levels of ICAM-1, NF-kappaB, and MCP-1 in patients are significantly elevated, suggesting an enhanced chronic inflammatory response and a significant correlation between inflammatory factors and the pathogenesis of cerebral aneurysm
26299331 Lipopolysaccharides up-regulate ICAM-1 expression in breast cancer cells via a MyD88-BLT2-ERK-linked signaling cascade.
26276826 leptin was able to directly activate airway epithelial cells by binding to Ob-R and by NF-kappaB activation, resulting in upregulation of ICAM-1 expression
26271977 Data show that intercellular adhesion molecule-1 (ICAM-1) expression in MCF-7 cells was down-regulated by ICAM-1 shRNA in lentiviral interference vectors.
26255081 genetic association study in Malaysian population: Data suggest that an SNP in ICAM1 [rs5498, K469E(A/G)] is associated with diabetic nephropathy (DN) in subjects with type 2 diabetes in the population studied; plasma ICAM1 is up-regulated in DN.
26231039 Contact-dependent lung adenocarcinoma aggregate dispersion by M2a macrophages occurs via ICAM-1 and beta2 integrin interactions.
26216937 neutrophils are reliant on endothelial activation for adhesion, initially via E-selectin and subsequently, by integrin-mediated binding to ICAM-1 and VCAM-1, combined with CXCL8-dependent chemotaxis.
26216891 Data show that interleukin-18 was involved in the eosinophil-mediated death of colon carcinoma cells via upregulation of CD11a/CD18 and ICAM-1 adhesion molecules.
26185364 suggest that ESE-1 may play a role in regulating airway inflammation by regulating ICAM-1 expression
26177712 ICAM1 expression and release is elevated during cellular oxidative stress and is enhanced by TNF.
26116870 ICAM1 levels were similar between pregnant women with and without preeclampsia and between non-pregnant women with and without a history of preeclampsia.
26109813 ICAM-1 may be a promising serological biomarker for HCC diagnosis and an independent predictor of disease-free/overall survival after surgical resection.
26088024 Extracellular UTP and ATP can attenuate ICAM-1 expression and leukocyte adhesion in endothelial cells through miR-22.
26081516 miR-222 was transported into recipient endothelial cells by endothelial microparticles and functionally regulated expression of its target protein ICAM-1 in vitro and in vivo.
26078712 ICAM-1 SNP rs281432 is an independent factor to predict the development of CAD. ICAM-1 SNP rs281432 homozygotic mutant GG can reduce the susceptibility to the CAD in Taiwanese subjects.
26048716 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
26031809 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
25994120 Identify the selectins ICAM-1 and VCAM-1 as strong and independent predictors of all-cause and cardiovascular mortality in patients with stable carotid atherosclerosis.
25990052 VCAM-1 and ICAM-1 have opposite roles in complications of diabetes
25985398 HIV-1 (NL4-3 derived NLENG1 (enhanced green fluorescent protein, (EGFP) gene linked with internal ribosome entry site between env and nef genes)) cell-to-cell transmission from lymphocytes to astrocytes requires ICAM1
25972323 Our results support that osteopontin regulates ICAM-1 and VEGFA expression mainly in triple-negative/basal-like breast carcinomas
25942347 the G241R polymorphism was not found to be associated with susceptibility to either CD or UC.
25896473 Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1.
25884075 The positive correlation is established between content of polymorphic nuclear monocytes and level of expression of molecules of LFA-1, ICAM-1, LFA-3, and PECAM-1.
25859827 protection of the ICAM-1 K469E polymorphism among the Asians (OR 0.91-0.95, p = 0.35-0.71) with endometriosis. These effects were weak but non-heterogeneous (P heterogeneity = 0.17-0.57, I (2) = 0-40 %)(Meta-Analysis)
25857767 Data suggest plasma levels of VCAM1 (but not ICAM1) are up-regulated in Asian subjects (Singapore) with type 2 diabetes mellitus complicated by chronic renal insufficiency; plasma levels of ICAM1 appear to be up-regulated in systemic inflammation.
25784313 Level of circulating ICAM-1 cannot be used as marker of aortic stiffness in patients.
25712667 The effect of IL-35 on electrical impedance reflecting tissue integrity, the surface expression of ICAM-1 and mRNA expression of IL-32, as well as apoptosis in human primary aortic smooth muscle cells (Ao-SMCs) was investigated
25654110 ICAM-1 can be considered as a rapid-reacting and sustained gravity-regulated molecule in mammalian cells.
25653483 These results suggest that high serum levels of IL-8 and ICAM-1, which are important as neutrophil attractants and adhesion molecules, are associated with progressive massive fibrosis.
25620704 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
25596452 A higher percentage of circulating CD4(+) T-cells expressed ICAM1 in relapsing-remitting multiple sclerosis compared to healthy controls.
25586702 ICAM-1 and ICAM-4 play roles in host cell invasion by M. tuberculosis and P. falciparum, respectively.
25573100 ICAM1 expression in activated eosinophils was associated with NP remodeling, indicating the possibility that ICAM1 may regulate NP remodeling.
25503951 ICAM-1 K469E polymorphism confers a risk factor of coronary artery disease.
25495610 ICAM-1 over time was most consistently associated with the risk of post-thrombotic syndrome.
25454473 In inflamed villi of chronic villitis, the level of ICAM-1 expression on immune cells depends on their location: high in number of cells in the perivillous region and low within the villi.
25450269 Overall survival was significantly shorter in patients with high LVD and ICAM-1 or VCAM-1 expression in lymphatic vessels.
25445193 Repeated social defeat-induced VCAM-1 protein expression were localized to the vasculature of brain regions implicated in fear and anxiety responses.
25427141 ICAM-1 and ICAM-2 are involved in each step of neutrophil extravasation, and have redundant but also distinct functions. Analysis of the role of endothelial ICAM-1 requires simultaneous consideration of ICAM-2.
25361845 Mutant KRAS-induced expression of ICAM-1 in pancreatic acinar cells causes attraction of macrophages to expedite the formation of precancerous lesions.
25360558 The current study examined the cytoadherence patterns of lab-adapted patient isolates after selecting on ICAM-1.
25358349 endothelial sICAM-1 expression levels might be accepted as an indicator of the severity of perinatal asphyxia in LBW infants.
25324196 Results indicate that specific gene variants in ICAM1, PPARGC1A and MTHFR are associated with different non-proliferative diabetic retinopathy phenotypes, being likely candidates to explain different disease mechanisms underlying the different phenotypes.
25320329 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
25320314 Authors found that a series of acidic residues in the matrix protein domain of HIV-1 interact with basic amino acids located in the ICAM-1 cytoplasmic tail.
25320314 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
25316052 Levels of ICAM-1 and TIMP-1 were significantly elevated in set 1 in PDAC patients with jaundice compared to PDAC patients without jaundice and both proteins were elevated in patients with jaundice due to gall stones.
25310099 The results indicated that the ICAM-1 polymorphisms were associated with risk of coronary atherosclerotic stenosis in Chinese individuals.
25306212 Secondhand smoke exposure (measured by hair nicotine) was associated with increased soluble ICAM1 in children and adolescents.
25287126 There was a significant increase in plasma AM, VCAM-1, and ICAM-1, while a significant decrease in plasma basic-Fibroblast growth factor (b-FGF) in diabetic patients with peripheral vascular disease (p < 0.05).
25283845 upregulated in choriodecidua following labor
25267626 ICAM-1 is a potential molecular target and biomarker for triple negative breast cancers therapy and diagnosis.
25251368 Data show that family with sequence similarity 5 member C protein FAM5C-positive endothelium expressed intercellular adhesion molecule-1 (ICAM-1) or vascular cell adhesion molecule-1 (VCAM-1).
25245399 Jurkat cells can over-express MIP-1alpha, which up-regulates the expression of endothelial adhesion molecules VCAM-1 and ICAM-1 to promote Jurkat cells' transendothelial migration
25201247 in human aortic and vein endothelial cells, expression and release of ICAM-1 and E-selectin were induced by treatment with conditioned medium collected from Pal-stimulated pTHP-1 cells
25179218 TNF-alpha augments invasion of Porphyromonas gingivalis in human gingival epithelial cells through increment of ICAM-1 and activation of Rab5.
25172543 study supports the possible influence of sICAM-1 and PEDF on the pathophysiology of retinal neovascularization in SCD patients.
25156105 Cerebral malaria isolates bind significantly more to CD36 than to ICAM-1, which was correlated with high transcription level of group B var genes, supporting their implication in malaria pathogenesis.
25145994 This study suggesyed that the possibility of the development of ICAM1 K469E E allele-specific therapeutics for the prevention and treatment of migraine in the Chinese Han population.
25138157 CD44/selectin binding signals increased intercellular adhesion molecule 1 up-regulation on the endothelial cells (ECs)surface through a PKCalpha-p38-SP-1 pathway, which further enhances melanoma cell adhesion to ECs during metastasis
25128351 The study revealed that individuals with ICAM-1 variant (EE) genotype were more susceptible to symptomatic neurocysticercosis.
25069049 Cannabinoid-induced upregulation of ICAM-1 on lung cancer cells, was found to be responsible for increased cancer cell lysis by lymphokine-activated killer cells.
25064159 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
25045892 mRNA were analyzed by RT-PCR and agarose gel. With beta-amyrin, the 50% RAW conditioned media-induced E-selectin, sICAM-1, and sVCAM-1 levels as well as ET-1 gene expression were all suppressed.
25038453 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by TTP in HPMEC.
25034460 Plasma soluble VCAM and ICAM in coronary ectasia are elevated in comparison to atherosclerotic coronary artery disease.
25032222 silibinin inhibits ICAM-1 expression and its function through altered O-linked glycosylation in NF-kappaB and STAT1 signaling pathways
25025994 Review/Meta-analysis: suggest that the ICAM-1 K469E polymorphism was a risk factor for coronary artery disease.
25003170 Examined the association between polymorphisms of the gene encoding intercellular adhesion molecule 1 (ICAM1) and tobacco smoke exposures with childhood asthma. Results indicate ICAM1 and ETS interaction may contribute to development of childhood asthma.
24993975 The rs5498 polymorphism of the ICAM-1 gene was associated with coronary heart disease in males in the Chinese Han population. Males with the G allele (AG and GG genotype) may have a higher risk of CHD than those with the AA genotype.
24979620 Increased ICAM-1 consistent with the time course of SAOS-2 binding, while antibody against ICAM-1 inhibited SAOS-2 adhesion.
24945611 Priming by CCL21 restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nanoaggregates on human mature dendritic cells.
24942509 K469E polymorphisms of ICAM1 that play a role in atherosclerotic pathogenesis are related to CORONARY SLOW FLOW
24940033 These findings indicate that VEGF-A(165)b inhibits TNF-alpha-mediated upregulation of ICAM-1 expression and increases monocyte-retinal pigment epithelial cell adhesion.
24857933 a role for endothelial cell ICAM-1 expression in bladder cancer cell adherence
24836091 Serum ICAM and VCAM levels are higher in first episode mania than those in subsequent remission and healthy individuals.
24797984 Increased expression of the intercellular adhesion molecule-1 on peripheral blood neutrophils is associated with acute pancreatitis.
24795464 These studies demonstrate that ICAM-1 immunobiology is highly complex but that individual isoforms, aside from the full-length molecule, make significant contributions to disease development and pathogenesis.
24792184 genetic susceptibility to diseases related to ICAM-1 polymorphisms, G241R or K469E, might be due to the different expressions of ICAM-1 variants rather than to the single-molecule binding ability of ICAM-1
24789429 the rs5498 polymorphic genotypes of ICAM-1 might contribute to the prediction of susceptibility to and pathological development of urothelial cell carcinoma.
24785937 the present meta-analysis showed no evidence of significant association between ICAM-1 gene K469E polymorphism and stroke in the Chinese population.
24779300 Serum level of ICAM-1 is higher in the presence of ascites in liver cirrhosis
24742333 E2F1 knockdown inhibited prostate tumor growth in vitro and in vivo through sensitizing tumor cells to ICAM-1 mediated anti-immunity by NF-kappaB modulation, highlighting the potential of E2F1 as a therapeutic target.
24702024 findings reveal a novel function of ICAM-1 in osteogenesis and suggest a new molecular target to improve bone regeneration and repair in inflammatory microenvironments.
24685520 Data suggest that up-regulation of TGFA (transforming growth factor alpha)/EGFR (epidermal growth factor receptor) signal transduction activates transcription factor NFkappaB resulting in up-regulation of expression of ICAM1 in osteosarcoma cells.
24667918 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
24667577 Adiponectin-induced ICAM-1 expression promoted the adhesion of monocytes to human OASFs.
24663101 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
24645721 meta-analysis. Behcet's disease was associated with the ICAM1 E469, genotype ICAM1 469 E/E, ICAM1 241 G/R polymorphisms in different ethnic groups. Among patients, genotype ICAM1 469 E/E had a significant association with skin lesion.
24631282 Placentas with Massive chronic intervillositis have more stICAM-1 than placentas with or without villitis lacking Massive chronic intervillositis.
24614587 vFLIP alone induced expression of the NFkB responsive genes ICAM1 and TNFalpha, inclusion of RTA decreased vFLIP induced ICAM1 and TNFalpha expression.
24612665 K469E polymorphism in ICAM-1 gene might not affect individual susceptibility to Type 2 diabetes mellitus (Meta-analysis)
24591755 ICAM1 KE and EE genotypes of K469E polymorphism could increase risk of severe preeclampsia.
24585879 Data indicate that ICAM-1 signaling activates leukemia-associated Rho guanine nucleotide exchange factor (LARG), also known as Rho GEF 12 (ARHGEF12).
24576947 HDL's anti-inflammatory properties are conferred, in part, through HDL-miR-223 delivery and translational repression of ICAM-1 in endothelial cells.
24558466 Elevated plasma levels of hsCRP, sICAM-1 and sE-selectin were positively and significantly associated with increased risk of dyslipidemia among Mongolians.
24534074 Data from multiple sites in United States suggest serum level of ICAM1 can be modulated by diet; up-regulation of serum ICAM1 correlates with coronary heart disease risk and may serve as marker of vascular endothelial dysfunction in young adulthood.
24516598 Concentrations of intercellular adhesion molecule (ICAM) -1, E-selectin, L-selectin, and P-selectin in serum samples from patients with systemic sclerosis were measured.
24474251 ICAM-1 may play an important role in Barrett's esophagus.
24465662 Data indicate that elevated levels of intercellular adhesion molecule-1 (sICAM-1) and vascular cell adhesion molecule-1 (sVCAM-1) were positively associated with preterm delivery independent of usual risk factors.
24457076 These results all suggest that ICAM-1 in both ductal epithelium and endothelium plays important roles in the inflammatory process of plasma cell mastitis, possibly through margination, extravasation, and attachment of plasma cells and lymphocytes
24456036 In type 1 diabetes, parameters of wave reflection are related to serum markers of inflammation, ICAM1 and C-reactive protein.
24393359 ICAM1 is likely to be involved in the development of childhood asthma.
24386348 High levels of sICAM-1 were associated with cerebral malaria
24359561 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
24345805 Transmigrated neutrophils in the intestinal lumen engage ICAM-1 to regulate the epithelial barrier and neutrophil recruitment.
24324686 The results showed that TNF-alpha, IL-10, ICAM-1and VCAM-1 were 3-fold, 3.7 fold and 2 fold increased between uncomplicated and complicated vivax malaria cases.
24312591 ligation of PSGL-1 on HL-60 cells activates beta2 integrin, for which lipid raft integrity and Syk activation are responsible
24289603 ICAM-1 R241G gene polymorphism is associated with brain tumors.
24282904 Overexpression of NFkappaB, ICAM1, and VCAM1 may be involved in the development and maintenance of atrial fibrillation in patients with rheumatic heart disease
24276753 NF-kappaB/ICAM-1 pathway induced adhesion of neutrophils and was involved in renal injury after hypoxia-ischemia injury.
24273934 IL-1alpha regulated its sub-network genes including CXCL1, CXCL10, and ICAM1 mRNA levels in time dependent but not in concentration dependent manner
24266503 Bereaved respondents had higher levels of inflammatory biomarkers IL-6 and sE-selectin, but not CRP and sICAM-I than the non-bereaved.
24222216 TNF-alpha-activated endothelial cells promote smooth muscle cell proliferation and secretion of ICAM-1 and IL-8 by elevating IL-6 release.
24204260 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
24162270 ICAM-1 plays an important role in both innate and adaptive immune responses. it appears to be crucially involved in the process of acute rejection after transplantation
24157824 Our study suggests that CCL5/RANTES, sICAM-1, and sVCAM-1 play a potential role in the pathogenesis of chronic spontaneous urticaria (CSU) but they do not parallel disease activity and are not predictive of the response to H-antihistamine therapy.
24088748 This study demonstrates that the early stages of diabetic retinopathy cannot be considered in the evaluation of serum ICAM-1 as a specific systemic marker of endothelial dysfunction.
24083591 K469E gene polymorphism of ICAM-1 was related to acute coronary syndrome recurrence and cardiovascular mortality
24077340 Inflammatory gene polymorphisms were not associated with arterial stiffness.
24069166 Gene-environment interactions of ICAM-1 polymorphisms, smoking, and betel-nut chewing might alter oral-cancer susceptibility.
23953534 Suggest that the rs5498 ICAM1 GG genotype may be associated with long-term allograft function in kidney transplantation.
23935498 a human ICAM-1 domain-1-specific antibody can prevent major group HRV entry and induction of airway inflammation in vivo.
23933413 The rs5498 G allele of ICAM1 protein was associated with a higher risk of developing epithelial ovarian cancer.
23922864 The K469E polymorphism in ICAM-1 gene might affect individual susceptibility to diabetic microvascular complications.
23922493 An increase in serum VEGF and ICAM-1 levels is associated with an increase in the severity of diabetic retinopathy and the grade of external limiting membrane and inner segment-outer segment junction disruption.
23906304 High ICAM1 expression is associated with high endothelial activation and breast cancer.
23904363 IL-4 was found to augment the mRNA expression of ICAM-1.
23884579 Baseline soluble ICAM-1 could be evaluated as an additional prognostic factor in patients with small-cell lung cancer.
23845107 Staphylococcus epidermidis induced higher levels of IL-8 (mean 38.5 ng/mL) and ICAM-1 mRNA (mean ratio 1.037) in the small airway epithelial cells than S. aureus (IL-8 mean 22.2 ng/mL, p < 0.01 and ICAM-1 mRNA mean ratio 0.715, p < 0.01).
23844251 Data suggest that soluble ICAM-5 increases glutamatergic transmission and that post-synaptic changes, including increased phosphorylation and dendritic insertion of GluA1.
23832872 Loss of ICAM-1 expression is associated with ovarian tumorigenicity and chemoresistance.
23803661 results indicate that BK enhances the migration of prostate cancer cells by increasing ICAM-1 expression through a signal transduction pathway
23792525 The rs5498 ICAM1 GG genotype is correlated with early and long-term renal allograft failure.
23777204 The the increased IFN-gamma levels in patients lead to increased ICAM1 expression, which could be a probable link between cytokines and T-cell involvement in pathogenesis of GV.
23770055 TNFalpha treatment activates autocrine S1P/S1P2 signaling, which subsequently activates NFkappaB and leads to the proinflammatory responses in endothelial cell
23728723 ICAM-1 expression in vascular endothelium is suppressed following blockade of NF-kappaB activation.
23726130 High expression of CD54 in breast neoplasms was associated with cytokeratin-positive cells in bone marrow, but not with lymph node metastasis.
23690481 we investigated a role of CCL15 in upregulating ICAM-1 in endothelial cells
23685129 Significantly elevated levels of anti-ICAM-1 antibodies were detected in patients.
23677452 dynamics of monocyte expression of VCAM-1r, ICAM-1r, and IL-6r following myocardial infarct and their relation to inflammatory cytokines, fibrinolytic factors and annexin V-binding microparticles
23676335 Data suggest that exposure of vascular endothelial cells to hyperglycemia for 48 or 72 hours significantly up-regulates ICAM1 expression at both protein and mRNA levels; gasotransmitters hydrogen sulfide inhibits this process.
23671702 Data show that curcumin-loaded polyvinylpyrrolidone nanoparticles (CURN) decreased the expression of ICAM-1, inhibited NADPH oxidase (NOX)-derived ROS generation, and reduced MAPKs and AP-1 transcription factor binding activities.
23663325 To assess intercellular adhesion molecule (ICAM)-1 expression.
23625043 Exposure of human coronary artery endothelial cells to constant high glucose induces expression of IL-6, TNF-alpha and ICAM-1, and the production of these proinflammatory cytokines is further enhanced in periodic high glucose.
23616566 Data indicate that up-regulation of ICAM-1 on TNF-alpha-activated MDA-MB-231 cells through the Nf-kappaB pathway was critical in MDA-MB-231-monocyte aggregation and endothelial adhesion.
23609612 The ICAM-1 Kilifi allele may play a role in malaria resistance amongst various African ethnic groups.
23581432 ICAM-1 and MAC-1 have roles in fibrinogen-inhibited neutrophil adhesion
23576799 Further, plasmin stimulates the NF-kappaB/p38-dependent expression of ICAM-1 by human umbilical vein endothelial cells.
23561648 Soluble intercellular adhesion molecule 1 was positively correlated with carotid intima-media thickness, independently of truncal fat, age and blood pressure.
23558934 ATX activity and gene expression are reliable diagnostic and prognostic tools in thyroid carcinoma compared to sICAM-1.
23555914 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
23554905 Neutrophil priming led to the rapid expression of a common set of transcripts for cytokines, chemokines and cell surface receptors (CXCL1, CXCL2, IL1A, IL1B, IL1RA, ICAM1).
23551616 These findings identify the molecular pathways underlying the high-glucose-treated Porphyromonas gingivalis-dependent ICAM-1 expression in human gingival fibroblasts.
23502765 adhesion molecules, principally CD54, are involved in the efficiency of recognition by effector chimeric zeta.
23493781 A possible paracrine role of released platelet miR-320b on endothelial cell intercellular adhesion molecule-1 expression was shown.
23457623 TWEAK acted as an inducer of E-selectin and ICAM-1 expression in mice with cutaneous vasculitis and human dermal microvascular endothelial cells
23438786 D-ribose ameliorates cisplatin-induced nephrotoxicity and inhibits upregulation of TNF-alpha and ICAM-1mRNA expression.
23417849 activation of leptin synthesis in a diabetic environment promotes ICAM-1 activation via mitogen-activated protein kinase pathway in type 2 diabetic patients.
23383040 severe DV infections induce MIF expression, which in turn stimulates monocytes or endothelial cells to express TM and ICAM-1 via the Erk, JNK MAPK and the PI3K signaling pathways
23376424 ICAM-1 is a marker of HCC stem cells in humans and mice; ICAM-1 inhibitors slow tumor formation and metastasis in mice. ICAM-1 expression is regulated by the stem cell transcription factor Nanog.
23376231 Our study uncovers the novel mechanism by which redox alteration associated with loss of p53 in stromal fibroblasts functions as a key inducer of epithelial transformation and invasion via RNS-mediated ICAM1 signaling
23364881 ICAM-1 plays an important role in tongue squamous cell carcinoma progression, which may result from the squamous cell carcinoma-cell activity, angiogenic activity, lymphangiogenic activity and macrophage/squamous cell carcinoma-cell adhesion.
23356193 Maternal circulating level of ICAM-1 is elevated in pregnant women with hypertension or pre-eclampsia.
23349778 Data indicate that the highest values of ICAM-1 were found in patients having an acute myocardial infarction (AMI) and who were antibody positive for dUTPase.
23297413 Molecular architecture of a complex between an adhesion protein from the malaria parasite and intracellular adhesion molecule 1
23264465 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23238746 Data indicate that knockdown of SIRT1 by RNA interference (RNAi) resulted in increased expression of ICAM-1 in human umbilical vein endothelial cells (HUVECs).
23232649 SphK1 regulates tumor cell proliferation, apoptosis and invasion, which ultimately contributes to tumor progression and malignancy phenotype in colon cancer. FAK pathway, ICAM-1 and VCAM-1 may play critical roles in this SphK1mediated effect.
23227846 an association between sICAM-1 levels and active smoking in a group of COPD and non-COPD active smokers
23209327 Group A PfEMP1 proteins are not central to ICAM-1-specific adhesion of infected human erythrocytes; instead, the tests support development of a vaccine to prevent cerebral malaria.
23202514 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
23178493 this is the first study showing the crucial role of NF-kappaB/Stat3 nuclear association in IR-induced ICAM-1 regulation and implies that targeting NF-kappaB/Stat3 interaction may have future therapeutic significance in glioma treatment.
23162921 serum sICAM-1 has important clinical significance for assessing the PHC patient's condition, early diagnosing and treating liver cancer.
23144497 Kindlin-3 association with LFA-1 is significantly increased at sites of high-affinity bond formation with ICAM-1 only in the presence of hydrodynamic shear stress.
23137758 The study revealed an association between the ICAM-1 gene marker, rs281437, and the progression of hepatic fibrosis in HCV genotype 4.
23111892 High glucose increased the expression of ICAM-1, which was partially abolished by sarpogrelate hydrochloride.
23098564 Our findings support the hypothesis that ICAM-1 up-regulation stimulated by SDF-1 may play an active role in CRC cell adhesion.
23095194 Value of testing two biomarkers, based on soluble intercellular adhesion molecule-1 (Leakection) and insulin like growth factor-binding protein-1 (Amnioquick), for the diagnosis of prelabor rupture of membranes. Both show high sensitivity and specificity.
23089253 Enhanced cytokine production and ICAM-1 expression are dependent on RIG-I activation in Denv infection of human brain microvascular endothelial cells (HBMECs.
23057424 Data suggest that plasma levels of ICAM1 (intercellular adhesion molecule-1) and VCAM1 (vascular cell adhesion molecule-1) are up-regulated in adolescents with type 1 diabetes in poor glycemic control.
23053969 The G241R and K469E single nucleotide polymorphisms of ICAM-1 gene may be related to occurrence of Hashimoto thyroiditis.
23053371 Up-regulation of ICAM-1 mRNA was significantly correlated with over-expressions of NF-kappaB p50 and NF-kappaB p65 (r = 0.8995, P < 0.01; r = 0.7601, P < 0.01).
23042271 papC inhibited the expression of VCAM-1 and ICAM-1, Il-8 after activation with TNF-a.
23039186 Demonstrated that melanoma cells can cross endothelial monolayers in vitro due to the induction of ICAM-1 and LFA-1 occurring during the co-culture of melanoma and endothelial cells.
22990627 Exercise duration is not of importance in ICAM-1 regulation in marathon/half-marathon runners.
22976263 The postdialysis increases in ICAM-1/VCAM-1 are due to the effect of dialysis membranes and can be reduced with the use of high flux membranes.
22972240 Soluble intercellular adhesion molecule-1 (sICAM-1) levels were 40% higher in sedentary older men compared to young sedentary subjects, but they were not different between the young and older trained men.
22909232 a significant survival advantage attributed to blood group O and increased monocyte expression of CD36 and ICAM1 (CD54).
22908191 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
22905988 Higher serum VCAM-1 and ICAM-1 was associated with higher risk of peripheral arterial disease in hemodialysis patients.
22815910 d-alpha-tocopherol and d-gamma-tocopherol have opposing regulatory functions for ICAM-1-activated PKCalpha in endothelial cells
22804504 WASP-deficient T cells migrated in a normal proportion towards CXCL12, CCL19 and CCL21, but displayed an increased adhesion and elongation on ICAM-1
22782142 Data indicate that IGF-1 treatment decreased ox-LDL-induced ICAM-1 expression potentially through reducing HMGB1 release.
22780972 ICAM-1 469K/E gene polymorphisms are significantly associated with the risk of gastric low-grade dysplasia, but not related with severe chronic atrophic gastritis in a population with high risk of gastric cancer in Linqu County, Shandong Province, China.
22763828 PCNA expression was decreased but ICAM-1 expression was significantly increased in the NIDDM and cataract group compared with that of non-diabetic cataract patients
22763042 Data show in pulmonary microvascular endothelial cells (HPMECs), unfractionated heparin (UFH) significantly attenuated LPS-induced production of IL-1beta, IL-6, E-selectin and ICAM-1, as well as phosphorylation of p38 MAPK and NF-kappaB translocation.
22742445 we have shown here that the two cell adhesion molecules ICAM-1 and VCAM-1, although best known as inflammatory NF-kappaB target genes, are regulated differentially during Caco-2 differentiation
22717098 Serum ICAM1 level was associated with mean pulmonary arterial pressure, ESR, and VCAM1 in children with congenital heart disease.
22707713 suggest an important role for LFA-1/ICAM-1 interactions in immunoregulation concurrent with lymphocyte migration that may have implications at the level of local inflammatory response and for anti-LFA-1-based therapies
22706247 An increase in serum adiponectin concentration is an independent factor correlated with lowering of sICAM-1 concentration during smoking cessation
22705151 The aim of the study was to measure serum and cerebrospinal fluid (CSF) concentration of ICAM-1, IL-21 and IL-23 in patients with tick-borne encephalitis and neuroborreliosis.
22697794 The data indicate that the LFA-1/ICAM-1 interaction may limit apoptosis in HIV-1-infected T cells.
22685016 urinary sediment ICAM-1 level was significantly reduced in lupus nephritis, and the level inversely correlated with renal function
22648254 Ser 128Arg of E-selectin and the K469E of ICAM-1 polymorphisms may be involved in predisposition to atherosclerosis.
22646485 This study found a significant association between genetic variation in ICAM1 and risk of transplant-related mortality after allogeneic hematopoietic cell transplant.
22644863 IL-11 enhances the migration of the chondrosarcoma cells by increasing ICAM-1 expression through the IL-11Ralpha receptor, PI3K, Akt, and NF-kappaB signal transduction pathway.
22619799 ICAM-1 may play an important role in the pathogenic process of brain stem encephalitis caused by human enterovirus 71.
22609871 Atorvastatin significantly prevents atherosclerotic changes in rabbits with a high-cholesterol diet, possibly by lowering plasma lipids and decreasing over-expressed ICAM-1.
22609477 The carrier status of ICAM-1 T allele of K469E in end-stage renal disease patients was an independent risk factor for susceptibility to cardiovascular disease.
22593994 The G allele of the rs5498 polymorphism of the ICAM1 gene is significantly correlated with interstitial fibrosis and may also be correlated with other chronic histopathologic lesions seen in bioptates of the grafted kidney.
22591361 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
22588952 Body mass index ICAM-1 was significantly higher in the family history of type 2 diabetes group
22562265 The single nucleotide polymorphism g.1548A >G (K469E) of the ICAM-1 gene is associated with worse prognosis in non-small cell lung cancer.
22560286 an interplay between ICAM-1 and MLCK-dependent contractile forces mediates neutrophil transmigration through oxLDL-treated endothelium.
22558273 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
22552879 This study demonstrated regulation of alpha(M)-integrin on circulating mononuclear cells in Guillain-Barre syndrome (GBS), as well as an important role for alpha(M)-integrin-ICAM-1 interactions in pathogenic GBS patient leukocyte trafficking at the blood-nerve barrier in vitro.
22552687 in overweight/obese women with PCOS, exercise training does not change endothelial function markers VCAM-1, ICAM-1, PAI-1 or ADMA more than only following a high-protein, hypocaloric diet
22541082 ICAM-1 positive expression is observed in hepatoblastoma and ANLL M1, M2, M3 patients, whereas it is undetectable in fibrosarcoma, nephroblastoma and primitive neuroectodermal tumor patients.
22533155 The 1405A>G polymorphism in ICAM1 gene may affect mRNA splicing patterns that modify cell-cell interactions and influence inflammatory response in coronary disease.[review]
22525368 Data indicate that antibody blockade of intercellular adhesion molecule-1 (ICAM-1) significantly reduced Toxoplasma gondii tachyzoites migration cross retinal endothelial monolayers.
22523875 The distribution of genotype frequencies and the frequency of the K469 allele of the preeclampsia group were not significantly different from those of the controls. A similar trend was observed between the severe preeclampsia patients and the controls.
22523428 These findings are the first to suggest that an ICAM-integrin-mediated pathway contributes to susceptibility to systemic lupus erythematosus.
22497223 Data suggest that systemic levels of adhesion molecules (ICAM-1, VCAM-1/vascular cell adhesion molecule-1, E-selectin) have inverse association with tetrahydrobiopterin/dihydrobiopterin ratio in blood of normotensive type 2 diabetic patients.
22496445 data indicate that ICAM-1 could be a useful hypoglycosylation biomarker to assess gene complementation of CDG-I patient cells and to monitor improved glycosylation in response to therapeutic drugs
22489699 High ICAM1 is associated with lung adenocarcinoma with malignant pleural effusion.
22463128 Data indicate that the shear stress stimulation produced a significant increase of ICAM-1 expression at protein and mRNA levels in lymphatic endothelial cells (LEC).
22448134 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
22433250 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
22404936 Increases in adhesion frequency provide significant evidence of the role of epinephrine in BCAM/Lu-laminin and ICAM-4-alpha(v)beta(3) bonding, and suggest mechanisms of vaso-occlusion during physical exertion in sickle cell trait.
22396143 The findings of a decrease of PECAM-1 expression and an increase of ICAM-1 expression in preeclamptic placenta suggest the existence of functional roles of these adhesion molecules in the pathophysiology of preeclampsia.
22378736 Data suggest that plasma level of soluble ICAM-1 (which is associated with cancer risk) can be modulated by diet (i.e., omega-3 fatty acid intake).
22378734 Data suggest that plasma level of soluble ICAM-1 (which is a biological marker of inflammatory processes such as atherosclerosis) can be modulated by diet (i.e., omega-3 fatty acid intake).
22349390 K469E polymorphism of ICAM-1 may not affect the susceptibility of COPD and the expression of ICAM-1 in Han people from central and south of China in this study, but carriers of E allele are at high risk of developing severe stage of COPD.
22345292 results indicate that CCN3 enhances the migration of prostate cancer cells by increasing ICAM-1 expression through a signal transduction pathway that involves alphavbeta3 integrin, ILK, Akt and NF-kappaB
22324942 Elevated urine sVCAM-1 and sICAM-1 levels may be useful in identifying patients at risk of lupus nephritis.
22294843 Data suggest that polymorphisms of ICAM-1 K469E can be a useful biomarker for identifying individuals with higher risk of GC, predicting disease progression, and guiding individualized treatment.
22248682 sPLA(2) plays a significant role in mediating the inflammatory signals that induce ICAM-1 expression in lung cancer cells. Inhibition of the enzyme can significantly decrease ICAM-1 expression and subsequent cancer cell invasion.
22234743 Metastatic tumor cells displayed lower regulated ICAM-1 expression levels and were less sensitive to specific CTLs. ICAM-1 downregulation may be one mechanism by which tumor cells escape immunologic surveillance.
22226679 Lf bound to a DNA region in the ICAM-1 promoter
22226621 Lipopolysaccharide-induced ICAM-1 synthesis in human umbilical vein endothelial cells is regulated by GEF-H1/RhoA-dependent signaling pathway via activation of p38 and NF-kappaB.
22209338 Our results demonstrated in CRC patients significantly increased levels of soluble adhesion molecules (VCAM-1 and sICAM-1) and angiogenic factor (VEGF) as compared to control group.
22203486 This meta-analysis suggests that the ICAM1 gene K469E polymorphism is associated with coronary heart disease risk.
22198381 Data indicate that cannabinoids induce ICAM-1, thereby conferring TIMP-1 induction and subsequent decreased cancer cell invasiveness.
22183741 VCAM1 and ICAM1 gene expression and cell surface expression in human endometriotic stromal cells was inhibited by curcumin.
22119941 Results indicate that IL-6-634G/ICAM-1 469E carrier could be associated with increased susceptibility to end-stage knee osteoarthritis.
22103402 plasmodium VIR proteins can specifically mediate cytoadherence to the ICAM-1 endothelial receptor.
22059356 serum concentration is a potential marker for diagnosis of neonatal sepsis
22045868 IFN-gamma and TNF-alpha synergistically enhance NK cell cytotoxicity through NF-kappaB-dependent up-regulation of ICAM-1 expression in target cells, thereby promoting their conjugate formation with NK cells.
22023772 in patients with HVA there is an over-expression of ICAM-1, and that ultra-rush VIT significantly decreases ICAM-1 levels.
22015609 hUCB-MSC-derived sICAM-1 decreases Abeta plaques by inducing NEP expression in microglia through the sICAM-1/LFA-1 signaling pathway.
22010135 Genetic variations at the ABO locus are associated with circulating levels of ICAM1, P-selectin, and E-selectin.
22001052 Increased adhesion molecules expression in chronic rheumatic heart disease could be a part of the ventricular remodeling.
21987404 In the Chinese population, the distribution of the K allele frequency of the ICAM-1 E469K gene was indicated to be associated with CAD risk.
21980389 Results show that levels of CD3epsilon, CD25, CD68, and ICAM-1 mRNA in BCC biopsies may predict risk for new basal cell carcinomas.
21972703 The increased levels of ICAM-1 and C-Jun are negative prognostic factors for the patients with non-small cell lung cancer.
21895545 Data suggest that serum CD44, ICAM-1 and VCAM-1 can potentially be prognostic in patients with indolent non-Hodgkin lymphomas (NHL).
21890178 MIF may affect blood coagulation and anticoagulation through its influence on endothelial cell ICAM-1 and thrombomodulin expression.
21877251 expression in melanocytes is upregulated by RNA released from necrotic keratinocytes
21871109 High ICAM-1 is associated with low CD133+CD34+subset of endothelial progenitor cells.
21860531 Data suggest that activation of ERK1/2, p38 and JNK cascades may be involved in ICAM-1 expression in glomerular endothelial cells under diabetic conditions.
21850260 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
21843619 Ethyl gallate isolated from Pistacia integerrima Linn. inhibits cell adhesion molecules ICAM-1/VCAM-1 by blocking AP-1 transcription factor.
21840991 analysis of beta2-integrin and intercellular adhesion molecule 1 binding kinetics in tumor cell adhesion to leukocytes and endothelial cells by a gas-driven micropipette assay
21828047 ATGL knockdown increased monocyte adhesion to the endothelium through enhanced TNFalpha-induced ICAM-1 expression via activation of NFkappaB and PKC.
21816944 These results suggest that IL-1alpha produced by HTLV-I-infected Tax(+) T cells is crucial for ICAM-1 expression in lung epithelial cells and subsequent adhesion of lymphocytes in HTLV-I-related pulmonary diseases.
21808112 There was no significant difference between levels of soluble adhesion molecules VCAM-1 and ICAM-1 in patients with acute ischemic stroke and in controls
21804483 Report ICAM-1/VCAM-1 levels in asymptomatic dyslipidemic subjects and risk for manifestation of atherosclerosis.
21798038 Non-cysteine linked MUC1 cytoplasmic dimers are required for Src recruitment and ICAM-1 binding induced cell invasion.
21725974 Transcriptional profiling of ATRA-treated SCC-9 cells showed upregulation of ICAM1, which plays an important role in inhibiting invasion and metastasis.
21724992 a signaling pathway involving aldose reductase, JNK, IKK, and NF-kappaB is required for ICAM-1 induction in ECs exposed to BFT, and may be involved in the leukocyte-adhesion cascade following infection with ETBF.
21717173 There is not any association between G241R or K469E polymorphisms within the ICAM-1 gene and susceptibility to polycystic ovary syndrome.
21680714 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21668410 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
21658317 ICAM-1 may be considered as a good marker of jonit prosthesis infection, distinguishing between patients with and without infection, and between patients with infection and those with previous infection.
21641584 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
21635548 ICAM-1 positive hepatocytes were seen in nonalcoholic steatohepatitis (NASH) patients and were localized in areas with microvesicular fat; the sICAM-1 were significantly higher in NASH-patients (339.8 +/- 34.07) than in non-NASH patients
21628959 Allergen exposure needs to cause weak or moderate cytotoxicity for DD86 and CD54 expression.
21610569 Data found that blocking CD11b, CD18, or CD54 on the endothelial progenitor cells (EPC) surface with monoclonal antibodies protected EPCs, enhancing its survival.
21594636 elevated admission levels of IL-6, but not soluble adhesion molecules, provide valuable information for risk assessment of long-term cardiovascular mortality in patients with acute ST-segment elevation myocardial infarction
21590495 Results indicate that ICAM-1 protein overexpression is associated with an unfavourable prognosis in breast cancer.
21571262 In dendritic cells, aging can impair the expression of ICAM-1 and CD25 and skew the production of cytokines, including IL-18, which concur to make a pro-inflammatory milieu.
21551251 PMN sialidase could be a physiologic source of the enzymatic activity that removes sialyl residues on beta2 integrin and ICAM-1, resulting in their enhanced interaction, and may be an important regulator of the recruitment of these cells to inflamed sites
21542832 Paeoniflorin suppressed the activation of the NF-kappaB pathway, which regulates the expression of ICAM-1.
21540444 hyperketonemia can induce monocyte adhesion to endothelial cells and it is mediated via increased ICAM-1 expression in endothelial cells and increased expression and affinity of LFA-1 in monocytes
21536861 investigation of activated T-lymphocyte spreading on ICAM-1 and ICAM-1-expressing dendritic cells: multimerization of LFA-1/ICAM-1 is involved and is facilitated/stabilized by kindlin-3
21536333 There is significant attenuation of extravascular and vascular ICAM-1 immunoreactivity in elderly subjects with major depression suggesting an astrocyte-associated alteration in immune function in the aging orbitofrontal cortex of subjects with MDD.
21520070 Resistin increased the expression of intercellular adhesion molecule-1, with this increases being p38MAPK-dependent. Resistin-induced monocyte adhesion was blocked by monoclonal antibodies against intercellular adhesion molecule-1.
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21474934 ICAM K469E allele was not associated with stroke/infarct dementia, mixed dementia, or subcortical ischemic vascular dementia
21392767 Polymorphisms in the ICAM1 gene predict circulating soluble intercellular adhesion molecule-1
21391218 our results indicate that CCN6 enhances the migration of chondrosarcoma cells by increasing ICAM-1 expression
21390226 Increased binding to CD36 is associated with uncomplicated malaria while ICAM-1 adhesion is raised in parasites from cerebral malaria cases.
21344487 Findings suggest that monocytes infiltration could directly induce EMT of HK-2 cells via upregulation ICAM-1 through NF-kB signaling pathway.
21328467 the RANKL and RANK interaction results in up regulation of ICAM-1 thereby increasing human lung cancer cell migration
21287514 The K469E polymorphism of the ICAM-1 gene was not associated with the susceptibility of rheumatoid arthritis.
21286024 Data show that the expression of ICAM-1 on endothelial cells (ECs) and neutrophil adhesion to ECs were attenuated by post-ischemic conditioning morphine administered during reoxygenation. period.
21270398 beta2 integrin engagement by ICAM-1 alone leads to tyrosine phosphorylation of the T cell receptor zeta-chain, Syk kinase, and phospholipase C (PLC)-gamma1 and PLC-gamma2 in human natural killer (NK) cells.
21236259 These results indicate that miR-221-mediated translational suppression controls ICAM-1 expression in epithelial cells in response to C. parvum infection.
21183871 These results suggest that ICAM1 gene polymorphisms play a minor role in pathogenesis of delayed graft function. The rs5498 ICAM1 gene polymorphism is associated with increased risk of acute rejection of kidney allografts.
21183689 Using leukocytes and endothelial cells, we show mechanistically that the silencing of Nogo-B with siRNA impairs the transmigration of neutrophils and reduces ICAM-1-stimulated phosphorylation of VE-cadherin.
21173732 Report age-related differences in the expression of ICAM-1 in the wall of varicose veins of women.
21172429 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
21171946 Syk activation is accompanied by formation of a protein complex consisting of ICAM-1, ezrin and Syk at the plasma membrane.
21162967 Increased levels of VCAM-1 and ICAM-1, E-selectin and P-selectin, as markers of inflammation, showed the importance of inflammatory processes in the development of atherosclerosis and clinical expression of CAD.
21159528 Homocysteine treated endothelial cells showed significantly increased expression of ICAM-1.
21078912 TCR signals fail to trigger LFA-1 headpiece activation unless the integrin first gets stabilized by surface-bound ICAM-1
21067572 Observational study of gene-disease association. (HuGE Navigator)
21039424 ICAM-1 from the synovial cells restored osteoclastogenesis suppressed by IL-6.
21037509 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20951945 Analysis using clinical biopsy specimens revealed autophagy and increased levels of BCL2, S1P1, and ICAM1 in human T-lymphoblastic lymphoma compared with T-lymphoblastic leukemia.
20940515 ICAM-1 gene polymorphism in codon 469 is associated with a risk for coronary heart disease in Egypitan subjects.
20940515 Observational study of gene-disease association. (HuGE Navigator)
20935502 intercellular adhesion molecule 1 (ICAM-1) and vascular cell adhesion molecule-1 (VCAM-1) work together with chemokines to induce immunosuppression mediated by mesenchymal stem cells
20929696 ICAM-1 does not have a dominant role in the development of restenosis following coronary stent implantation.
20890395 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
20880684 Sulphoraphane inhibited the expressions of intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 through MyD88-dependent toll-like receptor-4 pathway in cultured endothelial cells.
20864106 PTEN selectively inhibits expression of VCAM-1 but not ICAM-1 through modulation of PI3K/Akt/GSK-3beta/GATA-6 signaling cascade in TNF-alpha-treated endothelial cells
20837907 Epidermal growth factor-like domain 7 suppresses intercellular adhesion molecule 1 expression in response to hypoxia/reoxygenation injury in human coronary artery endothelial cells.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20725844 The results showed that the serum levels of sICAM-1 in Hemorrhagic fever with renal syndrome caused by Hantaan virus(HFRS) patients with fever, hypotensive, oliguric, and polyuric phases were significantly higher than those in controls (p < 0.001).
20714774 Levels of urinary ICAM-1 and VCAM-l in lupus nephritis patients with renal damage were statistically significantly higher than those in other groups (LN patients with mild histological changes or SLE patients without nephritis and control group
20712868 Patients with uncomplicated malaria had higher monocyte ICAM-1 expression consistent with a role for monocyte ICAM-1 in immune clearance during non-severe malaria
20685094 study showed that autoimmune-mediated dysthyroidism was associated with increased peripheral blood concentrations of vascular cell adhesion molecule-1(VCAM-1), intercellular adhesion molecule-1(ICAM-1) and tissue inhibitor of metalloproteinases 1(TIMP-1)
20681010 ICAM-1 can be transported to the immunological synapse through the recycling compartment; the high-affinity state of LFA-1 on T cells is critical to induce targeted movements of both ICAM-1 and MHC class II to the immunological synapse on APCs.
20680966 Data show that oncostatin M stimulation induced CXCL10 and ICAM-1 expression in human gingival fibroblasts stimulated with IL-1beta.
20665551 The findings of this work reveal a significant role for IL-17 in upregulating IVD cell inflammatory mediator release and ICAM-1 and suggest that IFNgamma and TNFalpha act synergistically to elevate an inflammatory phenotype in the presence of IL-17.
20662732 ICAM-1 is associated and correlated with the degree of atherosclerosis in type-2 diabetic hypertensive patients.
20647315 the PGE(2) and EP1 interaction enhanced migration of oral cancer cells through an increase in ICAM-1 production
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20596527 findings indicate that ICAM-1 clustering is regulated in an inside-out fashion through the actin cytoskeleton. Overall, these data indicate that signaling events within the endothelium are required for efficient ICAM-1-mediated leukocyte adhesion
20588308 Observational study of gene-disease association. (HuGE Navigator)
20587315 E-selectin, ICAM-1 and their ligands are important molecules of hepatocellular carcinoma and endothelial cells to tumor adhesive metastasis.
20585554 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20574001 Short-term hypoxia increases monocytic adhesion to cultured endothelial cells and monocytic ICAM-1 polyadenylated mRNA expression, while increasing adhesion of monocytic THP-1 cells to human and rat endothelial cells.
20570633 Data show that coculture with activated T cells upregulated expression of CD54 and CD58 and secretion of galectin-1 by MSCs.
20568250 Observational study of gene-disease association. (HuGE Navigator)
20566577 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
20552237 high molecular weight of HA suppressed the FN-f-activated p38 via ICAM-1 and the CD44 in RA chondrocytes
20536507 Observational study of gene-disease association. (HuGE Navigator)
20529672 Taken together with previous findings, our results indicate that membranous form of ICAM-1 on exosomes exhibits potent immune modulatory activity.
20511548 Synergistically enhanced by interferon-gamma and tumor necrosis factor-alpha, the expression of CD54 in mesenchymal stem cells (MSCs) enables CCR6 chemokine ligand CCL20 to induce in vitro adhesion of T helper (Th)17 cells to MSCs.
20510872 Our results show that there are no differences in infected red blood cells (IRBC) binding profiles across genotypes. We show in this study that homozygosity for the ICAM-1(Kilifi) is associated with child hospitalization.
20508517 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20494378 Independent associations in metabolic syndrome between the combined ICAM1-CRP (rs5491 and rs3091244) genotypes and MetS were found by multivariate analysis
20494378 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20473930 upregulated ICAM-1 expression in HPV16-E6E7-expressing keratinocytes led to enhanced conjugate formation with NK cells
20459645 blocking of OPN-induced ICAM-1 expression through mTOR/p70S6 kinase signaling pathway may be an important therapeutic strategy for the treatment of breast cancer.
20445114 the ICAM-1 G/R 241 polymorphism may represent a candidate gene for Fuchs uveitis susceptibility
20445114 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20432452 These results suggest that in human rheumatoid arthritis synovial fibroblasts, activation of ERK, JNK, AP-1, and NF-kappaB are essential for IL-1beta-induced ICAM-1 expression and leukocyte adhesion.
20430730 Results suggest that serum concentrations of sICAM, sVCAM and sE-selectin can reflect tumor progression and metastasis.
20422421 polymorphism in codon 241 associated with development of endometriosis susceptibility in the population of northern Iran
20422421 Observational study of gene-disease association. (HuGE Navigator)
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20409465 The impact of inside-out and outside-in signaling in neutrophils on the lifetimes and mechanical strengths of ICAM-1 bonds to beta2 integrin on the cell surface, was examined.
20409464 The results from tests of a monovalent ICAM-1 probe against immobilized alphaLbeta2 in environments of divalent cations, is presented.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20405289 Soluble ICAM-1 is significantly and positively associated with reticulocytes in steady-state sickle cell anemia patients.
20389059 Indoxyl sulfate upregulates expression of ICAM-1 and MCP-1 by oxidative stress-induced NF-kappaB activation
20362293 in healthy adolescents impaired endothelial function is significantly associated with high level of soluble ICAM-1, HOMA-IR and SFA
20360547 Intercellular adhesion molecule-1 polymorphism (G241R) predicts risk of incident ischemic stroke.
20360547 Observational study of gene-disease association. (HuGE Navigator)
20331378 Observational study of gene-disease association. (HuGE Navigator)
20304924 Engineering of single Ig superfamily domain of intercellular adhesion molecule 1 (ICAM-1) for native fold and function.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219985 GPx-1 modulates LPS-mediated up-regulation of ICAM-1 and VCAM-1 mRNA and protein in endothelial cells, in part, by altering CD14-mediated effects.
20217214 Down-regulation of ICAM-1 in mammary epithelial cells may contribute both to the high expression of psoriasin seen in some high-grade ductal carcinoma in situ and to the induction of MUC1.
20193033 Data show a significant decrease in L-selectin and increased E-selectin and ICAM-1 expression in HH patients.
20191078 The S128R polymorphism of the E-selectin gene is of interest for two reasons: first, it is overrepresented in certain patient groups affected by disease that is characterized by an increased adhesiveness of leukocytes to the endothelium
20191078 Observational study of gene-disease association. (HuGE Navigator)
20184510 VCAM-1, ICAM-1 and hsCRP were significantly associated with long term outcomes of patients with stable angina pectoris beyond the risk associated with traditional risk factors.
20167578 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20164172 Pharmacologic inhibition of Rho kinase 2 signaling blocked LPA-induced p65 phosphorylation and suppressed ICAM-1 and VCAM-1 expression.
20160446 The K469E and G241R polymorphisms in the ICAM-1 gene and the C-634G polymorphism in the IL-6 gene may not be genetic factors related to susceptibility to advanced-stage endometriosis in the Korean population
20160446 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20158572 Data show that PLT adhesion to HIMEC was ICAM-1, FKN and integrin alpha(v)beta(3) dependent.
20151764 Plasma levels of ICAM-1 and circulating endothelial cells are elevated in unstable types 1 and 2 diabetes.
20139322 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
20137698 ICAM-1 expression in human embryonic lung fibroblast cells infected with respiratory syncytial virus was 2.51 times that in normal cells.
20118004 The transcription level of ICAM-1 in HepG2 cells was reduced by different doses of cinobufagin.
20110463 miR-221 is involved in IFN-gamma-induced expression of ICAM-1 in cholangiocytes and further regulates inflammatory responses in cholangiopathies.
20107176 The p38 MAPKs and NF-kappaB pathways may play an important permissive role in CD40L-induced ICAM-1 expression in orbital fibroblasts
20083573 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
20056442 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20056088 HIV-1 Nef regulates ICAM-1 expression on endothelial cells via Map Kinase signaling pathway.
20056088 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
20004360 an ICAM- and IL-8-mediated neutrophilic airway inflammation in both obstructive sleep apnea and obese patients.
19954409 Data show that ICAM-1 levels are significantly higher in thrombocytopenia and thrombocytosis compared to control, while L-selectin levels are significantly higher in thrombocytopenia.
19949084 E-selectin and ICAM-1 are targets of TNF-induced miRNAs miR-31 and miR-17-3p, respectively.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19935876 Results show that Ets1 and Stat1 functionally interact to optimize ICAM-1 transcription.
19922364 Magnetic brain stimulation significantly decreases the expression of ICAM-1 in the choroids plexus of the rat brain and abruptly suppresses the induction of acute experimental autoimmune encephalomyelitis
19917355 ICAM-1 is up-regulated during cold ischemia in pancreas transplantation, possibly representing the mechanism of early neutrophil infiltration observed in human pancreatic ischemia/reperfusion injury.
19914206 up-regulation of CD44 and ICAM-1 expression on the surface of T. gondii-infected human monocytic THP-1 cells and fresh isolated human monocyte was demonstrated.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912576 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
19906207 K469E ICAM1 gene polymorphism was associated with Tunisian Behcet's disease patients with skin lesions
19906207 Observational study of gene-disease association. (HuGE Navigator)
19898481 Observational study of gene-disease association. (HuGE Navigator)
19896127 patients with nonalcohlic fatty liver disease showed significantly higher liver staining scores for ICAM-1 and PAI-1 than control liver biopsies.
19882756 expression of ICAM-1 and MHC antigens is up-regulated by CMV infection, which may be a key contributing factor of allograft rejection
19825506 Increased plasma ICAM-1 suggests inflammatory process may be involved in the pathogenesis of white matter lesion
19822019 KK genotype of ICAM-1 K469E is significantly associated with well differentiation of CRC.
19822019 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19764564 Both high pressure CO2 and 5% dextrose solution can increase the expression of CD44 and ICAM-1 in endometrial cancer cells.
19747913 ICAM-1 is coupled to intracellular signaling pathways involved in tumor cell migration. Neutrophil granulocytes can act as modulators of the metastatic capability of tumor cells by ligation of ICAM-1.
19729601 Observational study of gene-disease association. (HuGE Navigator)
19724852 CD54 was significantly correlated with deeper depth of invasion and advanced stage of tumor but not with lymph node status in primary gastric cancer
19717975 Results suggest that ICAM-1 and VCAM-1 are markers associated, and correlated with the degree of atherosclerosis in normotensive type-2 diabetic patients.
19714575 endogenously activated pleural fluid-derived NK cells express high ICAM-1 levels and induce T-cell activation ex vivo through ICAM-1 in tuberculous pleurisy.
19710135 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
19701972 Results examine the levels of serum soluble intercellular adhesion molecule-1 (sICAM-1), plasma D-lactate and diamine oxidase (DAO) in patients with inflammatory bowel disease.
19701669 Soluble ICAM-1 from patients with asthma was significantly higher than healthy controls.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19691982 lipopolysaccharide-stimulated ICAM-1 expression in human aortic valve interstitial cells is mediated by TLR4 and ICAM-1 interacts with microfilaments
19661147 The deregulation of MMP9, and the TNF participation in the MMP1 and proMMP9 secretions, in the MMP9 expression and in the expression and cleavage of ICAM1 may contribute to the pathophysiology of endometriosis disease.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19615354 an association of increased GA, hsCRP and sICAM-1 levels with diffuse coronary artery disease in patients with type 2 diabetes mellitus
19597294 sVCAM-1 and sICAM-1 serum levels reflected the clinical status in rheumatoid arthritis (RA}, independently of the ICAM1 and VCAM1 polymorphism. However, the ICAM1 721A allele could be a genetic marker to RA susceptibility
19597294 Observational study of gene-disease association. (HuGE Navigator)
19587357 Meta-analysis of gene-disease association. (HuGE Navigator)
19587009 suppressed ability of DCs to induce T cell proliferation was dependent on adhesive interactions between DCs and lymphatic endothelial cells that were mediated by the binding of Mac-1 on DCs to ICAM-1 on LECs.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19567179 Mechanical forces upregulate the expression of ICAM-1 in A549 cells.
19564823 Plasma E-selectin and soluble ICAM1 levels were significantly higher in the TT or TC genotype compared to that of the CC genotype.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19554506 Expressiom of ICAM1 gene of NF-kappaB pathway in multiple myeloma using bone marrow aspirates is reported.
19548631 The levels of E-selectin, ICAM-1, IL-11, IRF-1, IL-6, IL-1beta and LIF genes expression in the B. pseudomallei-infected cells were 1.5-5 times lower than in the B. thailandensis-infected cells.
19540498 Upregulation of PTEN by CKD712 inhibits VCAM-1 expression, but not ICAM-1 expression, in lipopolysaccharide-treated endothelial cells.
19526283 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
19524923 Carbon monoxide (from CORM-2) inhibits high glucose-induced ICAM-1 expression via AMP-activated protein kinase and PPAR-gamma activations in endothelial cells.
19524015 Data show that The cell surface expression levels of (ICAM)-2 and -3 on the apoptotic cells were markedly lower, while those of calnexin, calreticulin, and (LAMP)-1 and -2 were significantly higher compared to non-apoptotic cells.
19520829 Results show that Dicer is responsible for the generation of the mature miR-222 and -339, which suppress ICAM-1 expression on tumor cells.
19501575 ICAM-1 is mainly involved in the initial adhesion of osteoclast precursors whereas clustered ICAM-1 on osteoclast precursors and its association with F-actin suggest an involvement in cell movement at a later stage.
19500134 primary myeloma cells exhibit constitutively lower CD54 that might be partially regulated by CXCL12, and their localizations in the BM may be associated with the expression levels of CD54
19497039 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19494354 Efficient MTOC polarization at the virological synapse requires Tax-mediated stimulation of T-cell activation pathways in synergy with ICAM-1 cross-linking.
19483084 Cofilin-1 occupies a central position in RhoA-actin pathway mediating nuclear translocation of RelA/p65 and expression of ICAM-1 in endothelial cells.
19479237 Observational study of gene-disease association. (HuGE Navigator)
19452711 The overexpression of GATA-3 in patients with allergic rhinitis was related to the increase of ICAM-1.
19449444 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
19434537 Compared with open surgery, laparoscopy-assisted radical gastrectomy is not associated with a greater effect on the expression of ICAM-1 and integrin beta(1) in peritoneal mesothelial cells.
19429776 Fibrinogen binding to ICAM-1 promotes mucin production by decreasing TGF-alpha-induced EGFR and ERK1/2 activation.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19419934 The purpose of the study was to evaluate the percentage of CD4+/CD8+ peripheral T cells expressing CD62L+ and CD54+ in patients with Graves' disease.
19407978 Clotrimazole can inhibit TNF-alpha-triggered expression of adhesion molecules, ICAM-1 and VCAM-1, and angiogenesis during inflammation.
19407977 Resveratrol inhibits Porphyromonas gingivalis lipopolysaccharide-induced endothelial adhesion molecule expression by suppressing NF-kappaB activation.
19399399 The increased serum sICAM-1 and sVCAM-1 in Keshan disease patients may be related to CBV infection.
19373518 The purpose of the study was to investigate bone mineral density (BMD) in children with type 1 diabetes (DM1) and to establish the relationships between BMD, physical activity, glycemic control, and markers of systemic oxidative stress and inflammation.
19357230 Lipoxin A4 inhibits IL-1beta-induced IL-8 and ICAM-1 expression in 1321N1 human astrocytoma cells.
19353432 Expression of ICAM and VCAM was significantly upregulated on blood vessels and muscle fibres in idiopathic inflammatory myopathies as compared to controls
19351910 results suggest that p65/RelA and NFATc1 bind to the intronic NF-kappaB site 1 sequence to induce optimal transcription of the ICAM-1 gene in response to thrombin in endothelial cells
19343356 Increased expression of ICAM-1 in umbilical and placental vascular tissue does not occur in gestational diabetic women when compared with non-diabetic controls.
19340565 This study demonstrated the absence of a systemic TNF-alpha-mediated inflammatory response at the onset of subarachnoid hemorrhage. Measurement of serum sICAM-1 levels offers a potential prognostic value in the assessment of patients' outcome.
19338980 IFI16 mediates ICAM-1 stimulation by TNF-alpha through the NF-kappaB pathway, thus reinforcing the role of the IFI16 molecule in the inflammation process.
19332210 We found significant associations between certain candidate genetic polymorphisms and baseline plasma levels of FGB, homocysteine, and ICAM-1 in women from various race/ethnic groups.
19332210 Observational study of gene-disease association. (HuGE Navigator)
19330816 NMR solution structure of a novel T-cell adhesion inhibitor derived from the fragment of ICAM-1 receptor: cyclo(1,8)-Cys-Pro-Arg-Gly-Gly-Ser-Val-Cys.
19306055 ICAM-1 (Lys469Glu) and PECAM-1 (Leu125Val) polymorphisms in diffuse astrocytomas.
19306055 Observational study of gene-disease association. (HuGE Navigator)
19278584 Activation of NF-KappaB mediates IL-1beta induced ICAM-1 expression in A549 cells.
19263529 Observational study of gene-disease association. (HuGE Navigator)
19262138 P-selectin cross-links PSGL-1 and enhances neutrophil adhesion to fibrinogen and ICAM-1 in a Src kinase-dependent, but GPCR-independent mechanism.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19253530 IL-12 p35, ICAM-1 and MCP-3 mRNAs are expressed in primary nasal epithelial cells.
19249917 Obesity increased ICAM-1 expression in visceral adipose tissue.
19237221 Serum and intraocular concentrations of ICAM-1, VCAM-1, E-selectin, vWF were considerably higher in the subjects with proliferative diabetic retinopathy than in the controls.
19225705 Lower expression of ICAM-3 and higher expression of ICAM-1 suggest that AMs may be involved in the pathogenesis of scleroderma.
19225544 Observational study of gene-disease association. (HuGE Navigator)
19219419 Studies show ICAM-1 differentially expressed during the transition of the hormone-sensitive prostate cancer cell line LNCaP to its hormone-refractory derivative C4-2B with the ability to invade, and may therefore be a target for therapeutic intervention.
19217936 the adhesion molecule ICAM-1 is an independent predictor of depressive symptoms 12 months later in heart failure patients
19212205 No significant differences in allele or genotype frequencies were observed for ICAM-1 K469E, E-selectin, and PECAM-1 polymorphisms between Ulcerative Colitis patients, Crohn Ddisease patients, and controls.
19212205 Observational study of gene-disease association. (HuGE Navigator)
19211748 Blocking ICAM-1 in dendritic cells (DCs) with specific monoclonal antibodies and small interfering RNA impaired DC-mediated HIV-1 transmission
19203796 Lipid rafts are essential for the killing of tmTNF-alpha through the cell-cell contact mediated by ICAM-1.
19175829 Expression of ICAM-1 or ICAM-2 on human pancreatic cancer cells is critically important in determining the extent to which these cells are sensitive to killing by human gammadelta-T cells.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169973 Simultaneous carrier-state of MTHFR, IL-6 and ICAM1 genes increased the risk of Coronary artery disease.
19169973 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19154405 CCL2 induces selective and significant expression of ICAM-1
19141396 Serum levels of sICAM and VEGF were significantly higher in juvenile idiopathic arthritis (JIA) patients with capillary abnormalities than in JIA patients with normal capillaroscopy.
19136619 Liraglutide inhibits TNF- or glucose-mediated induction of PAI-1 and vascular adhesion molecule expression.
19136145 There was a significant correlation between E-selectin and ICAM1 in all patients.
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19129609 This review aims to further clarify the relationship between ICAM-1 and acute pancreatitis complicated by acute lung injury.
19114730 Results indicate that phosphatidylcholine hydroperoxide (PCOOH) evokes LFA-1-mediated cell adhesion to ICAM-1 via actin cytoskeletal organization, which may promote monocyte adherence to the arterial wall in the initiation of atherosclerosis.
19102398 IL-18 and sICAM-1 seem to be involved in the pathogenesis of severe acute pancreatitis, correlate with the disease severity and may be applied as prognostic markers.
19092999 sICAM-1 as a biochemical marker for oocyte maturation and grading.
19088500 Report downmodulatory effect of the antihistaminic drug bepotastine on CD54 expression in human keratinocytes.
19078988 Insulin resistance and elevated soluble intercellular adhesion molecule-1 levels were found in normotensive adolescents with a family history of hypertension.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19074768 an important role of PKC-delta and PI3K/Akt1,2 pathways in activating mTOR as an endogenous modulator to ensure a tight regulation of NF-kappaB signaling of ICAM-1 expression in endothelial cells.
19069650 Zinc sulfate stimulation could activate the EGFR and the PI3K/Akt signaling pathway, further leading to upregulation of ICAM-1 expression in human airway epithelial cells.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19055786 Association of the ICAM1 rs5498 (exon 6) G allele with increased risk of severe malaria was observed.
19055786 Observational study of gene-disease association. (HuGE Navigator)
19050286 Binding to dimeric ICAM-1, and not monomeric ICAM-1, is sufficient to elicit assembly of F-actin and phosphorylation of Src family kinases that colocalize with LFA-1 on adherent neutrophils.
19048183 Interactions between rs5498 polymorphism in the ICAM1 gene and traditional risk factors influence susceptibility to coronary artery disease.
19048183 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19030842 Elevated ICAM-1 levels are associated with risk of incident diabetes in the elderly, despite no association with incident cardiovascular disease risk.
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19022587 Our hypothesis could be proved by immunohistochemical stain of ICAM-1 and VCAM-1 in lesional and non-lesional skin of pv patient in comparison with healthy skin.
19021457 Amniotic fluid ICAM-1 (intercellular adhesion molecule 1) showed a tendency to decline with the last phase of cervical dilatation and a significant decline with labor
18996288 Observational study of gene-disease association. (HuGE Navigator)
18979153 These results indicate that ICAM-1 and sICAM have a dual effect on bone homeostasis, increasing osteoclast activity while lowering osteoblast anabolic activity.
18974842 Observational study of gene-disease association. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18945465 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
18942221 EE genotype of K469E polymorphism of ICAM-1 might be risk factor for proliferative diabetic retinopathy in Slovenian population (Caucasians) with type 2 diabetes.
18942221 Observational study of gene-disease association. (HuGE Navigator)
18930765 Plasma levels are increased after induction of endotoxemia with E.coli LPS
18928584 Treatment of K562 cells with bortezomib downregulates the expression of CAM-1 by inhibiting the activity of NF-kappaB.
18851856 The EE genotype of Intercellular adhesion molecule-1 K469E was significantly associated with increased risk of spontaneous preterm delivery
18851856 Observational study of gene-disease association. (HuGE Navigator)
18848929 Data show that serum concentrations of PLA(2)-IIA, Lp(a), ICAM-1 and PECAM-1 are higher for patients with unstable rather that stable angina and controls, and that high plasma Lp(a) is an independent risk factor for angina.
18848929 Observational study of gene-disease association. (HuGE Navigator)
18842965 ICAM-2 is expressed on the bronchial epithelium and, together with ICAM-1, has an essential function in the clearance of T cells from the lung
18834676 Overexpressed and may contribute to the development of fibrovascular membranes in patients with proliferative diabetic retinopathy.
18828734 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18820595 These results do not indicate a major impact of missense variants on ICAM-1 biological function.
18809679 identifies filamin B as a molecular linker that mediates ICAM-1-driven transendothelial migration
18801041 stimulation of brain microvascular endothelial with Streptococcus suis S735 resulted in shedding of sICAM-1; capacity of S. suis to induce ICAM-1 shedding has implications that may contribute to pathophysiological process of meningitis
18791855 ICAM-1 469E allele may be important in the pathogenesis of ischemic stroke, especially in female but not in male
18791855 Observational study of gene-disease association. (HuGE Navigator)
18791689 correlations found between sVCAM-1, sICAM-1 and sELAM-1 and the presence of retinopathy suggest that cellular adhesion and neovascularization may be linked processes
18787016 higher sICAM-1 and sVCAM-1 concentrations were independently associated with lower ankle-brachial index and peripheral arterial disease in blacks, but not in non-Hispanic whites
18768924 MDA-MB-231 produces ATP-mediated ICAM-1-dependent facilitation of the attachment of carcinoma cells to human lymphatic endothelial cells.
18761738 This independent association of postprandial triglycerides with sICAM-1 may indicate a particular impact of postprandial lipid metabolism on endothelial reaction.
18751468 associated with both an increased prevalence and severity of aortic valve calcium in a large, multi-ethnic, asymptomatic cohort
18710612 By inhibiting E-cadherin expression and enhancing ICAM-1 expression, LMP1 may reduce the cell-cell adhesive ability and improve the cell-matrix adhesive ability and migratory ability of nasopharyngeal carcinoma cells.
18707907 Gb3 induces oxidative stress and up-regulates the expression of ICAM1, VACAM1 and selectin E in Fabry disease vascular endothelial cells.
18703796 C/EBPbeta was found to have an important role in epithelial cell ICAM-1 regulation, while the adjacent NF-kappaB sequence binds the RelA/p65 and NF-kappaB1/p50 members of the NF-kappaB family to induce ICAM-1 expression in response to H. influenzae.
18703101 did not find any differences in genotypic or allelic frequencies of the ICAM1 G241R polymorphism between our Celiac disease patients and controls, and no differences were observed when the other SNPs were analyzed
18692491 VEGF, sVCAM-1, sICAM-1 and sE-selectin median levels were higher in hemodialysis patients compared to controls.
18683786 There was a significant correlation between over-expression of ICAM-1 and TIMP-land MMP-9 in lung tissues from patients with chronic obstructive pulmonary disease.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18667484 In renal proximal tubule cells , IL-8 upregulates ICAM-1 production by engaging the CXCR-1 receptor and p38 MAPK signaling pathway.
18656701 TNF-alpha can play a crucial role in the immunopathogenesis of nephritis by the induction of CCL2, ICAM-1 and VCAM-1 expression via the activation of the intracellular MAPK signaling pathway, which may contribute to macrophage and lymphocyte infiltration.
18647548 significant differences between healthy control group & Crohn patients were observed in mutation 1007fs of the NOD2 gene (P = 0.0203; results support previous findings about participation of mutations of NOD2 & ICAM-1 genes in inflamatory bowel disease
18636124 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18632854 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
18627514 cytokine and intercellular adhesion molecule-1 gene polymorphisms have roles in acute rejection in pediatric renal transplantation
18627514 Observational study of gene-disease association. (HuGE Navigator)
18626404 Erythropoietins down-regulate the expression of ICAM-1 and LFA-1, and through binding to LFA-1, they interfere with ICAM-1/LFA-1 interaction.
18613029 NF-kappaB, but not p38, is critical for TNF-alpha-induced expression of ICAM-1, VCAM-1 and E-selectin
18604267 that three SNPs at the ICAM1 (19p13.2)locus are non-redundantly associated with plasma sICAM-1 concentrations at a genome-wide significance level (P<5x10(-8)), thus extending prior results from linkage and candidate gene studies.
18604267 Genome-wide association study of gene-disease association. (HuGE Navigator)
18597403 Patients with inactive TA have elevated levels of sE-selectin, sVCAM-1, and sICAM-1 that might indicate persistent vasculopathy in clinically inactive disease.
18574676 renal expression is upregulated in rapidly progressive glomerulonephritis
18539414 Beryllium exposure produces up-regulation of ICAM-1 in small airway epithelial cells.
18528404 genetic association studies with 15 single nucleotide polymorphisms (SNPs) around the ICAM1 locus showed none of the polymorphisms were associated with severe malaria phenotypes
18528404 Observational study of gene-disease association. (HuGE Navigator)
18523306 Plays a nonredundant role in T cell receptor-driven formation of transendothelial protrusion and transendothelial migration.
18513389 Observational study of gene-disease association. (HuGE Navigator)
18508964 When human aortic endothelial cells were stimulated with physiologic concentrations of fructose, ICAM-1 mRNA and protein expression increased in a time- and dosage-dependent manner, which was independent of NF-kappaB activation.
18505543 SNP rs5498(E469K) presents a high heterozygous index, and the allele G of this polymorphism may confer the decreased risk susceptibility to the development of diabetic nephropathy in female type 1 diabetes
18505543 Observational study of gene-disease association. (HuGE Navigator)
18504269 Baseline ICAM-1 and VCAM-1 are increased in initially healthy middle-aged men who develop cardiovascular disease during 6.6 years of follow-up.
18486623 Demonstration that MK2 mediates post-transcriptional regulation by p38 MAPK of the TNF-induced expression of ICAM-1 in lung microvascular endothelial cells, and that this regulation by the p38 MAPK/MK2 pathway is dissociated from HSP27 phosphorylation.
18474291 Individuals carrying the A allele of the ICAM1 gene as well as the A/G haplotype may have a higher risk of developing breast cancer.
18474291 Observational study of gene-disease association. (HuGE Navigator)
18473826 sICAM-1 may play an important role for the pathogenesis of SBI in patients with diabetes mellitus.
18454303 Involvement of MT1-MMP activity in ICAM-1 ectodomain shedding.
18446055 TNF-alpha-induced ICAM-1 up-regulation in the airway epithelium is mediated by Rac1-ROS linked cascade via NF-kappaB-dependent manner
18440309 show for the first time increased ICAM-1 concentrations in Pseudoxanthoma elasticum patients
18440309 Observational study of gene-disease association. (HuGE Navigator)
18422166 The expression of ICAM-1 mRNA were significantly correlated with that of NF-kappaB p50 and NF-kappaB p65 in allergic rhinitis.
18420209 analysis of ICAM1 and VCAM1 polymorphisms, coronary artery calcium, and circulating levels of soluble ICAM-1 in atherosclerosis
18420209 Observational study of gene-disease association. (HuGE Navigator)
18415799 analysis of ICAM-1 expression in vaginal cells and its role in inflammation
18403635 These findings suggest a novel MUC1-Src-CrkL-Rac1/Cdc42 signaling cascade following ICAM-1 ligation, through which MUC1 regulates cytoskeletal reorganization and directed cell motility during cell migration.
18401716 Polymorphisms of the ICAM-1 gene are associated with biliary atresia.
18401716 Observational study of gene-disease association. (HuGE Navigator)
18392953 In rheumatoid arthritis, a high serum level of sICAM-1 was found compared to its level in the synovial fluid.
18363879 Data suggest that Moraxella catarrhalis lipooligosaccharide selectively upregulates ICAM-1 expression on human monocytes and stimulates adjacent naive monocytes to produce TNF-alpha through cellular cross-talk.
18362147 Syk signals downstream of PKC-delta to mediate thrombin induced ICAM-1 expression in endothelial cells by increasing transcriptional capacity of NF-kappaB via a mechanism that relies on tyrosine phosphorylation of RelA/p65
18361930 G241/E469 genotype of ICAM-1 is associated with greater cell surface expression of ICAM-1, which in turn leads to greater adhesion of leukocytes
18322230 Has an important role in maintenance of granulocyte-macrophage colony-stimulating factor receptor-mediated signaling in activated human eosinophils.
18297282 CD54 expression is substantially and consistently upregulated on antigen presenting cells during culture with a GM-CSF fusion protein
18295170 Plasma of pregnant women and women with preeclampsia up-regulated the percentage of ICAM-1-expressing cells after 4 hours and down-regulated the percentage of ICAM-1-expressing cells and MCB after 24 hours
18284603 Urotensin-induced expression of TF and of VCAM-1/ICAM-1 was mediated through the Rho A-activation of the transcription factor, NF-kappaB
18260262 ICAM-1 plays an important role in the pathogenesis of nasal polyps
18256065 the polygenotype of VEGF (vascular endothelial growth factor) +405/intercellular cell adhesion molecule (ICAM)-1 +241/IL6 (interleukin6)-174 (C-A-G) conferred an increased risk for Progressive Massive Fibrosis in Coal miners
18256065 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18243419 Our findings provide evidence that elevated CSF sICAM-1 and ACE are associated with lower perfusion levels in the parietal cortex of cognitively intact elderly.
18233990 The ICAM-1 polymorphisms at codons G241R and E469K were associated with the disease susceptibility, and susceptibility to active decompensated cirrhosis is significantly increased in chronic HBV carriers carrying at least one R241-E469 haplotype.
18233990 Observational study of gene-disease association. (HuGE Navigator)
18231758 There was an obvious correlation between the increase of TNF-alpha and that of ICAM-1 in lichen planus.
18230913 We conclude that ICAM-1 expressed on TRs is involved in PE pathogenesis and is regulated by cytokines
18227124 These findings revealed that TNF-alpha induced VCAM-1 expression via multiple signaling pathways.
18212564 Xenon, isoflurane, nitrous oxide, and morphine prevent TNF-alpha-induced mRNA and protein expression of intracellular cell adhesion molecule 1.
18200516 ICAM-1 downregulation could provide a new target for controlling the recruitment of leukocytes at the sites of inflammation in IBD.
18199704 Determined kinetic parameters of beta 2-integrin and ICAM-1 bindings bindings between neutrophils and melanoma cells in a shear flow.
18197885 Mean sICAM-1 value was higher in patients with active giant cell arteritis than in cluster headache patients during the active cluster period.
18186794 Investigating a sample of living-unrelated donor kidney transplant pairs, study revealed an association between recipient K469 allele of ICAM1(P = 0.013) and K/K genotype (P = 0.042) with renal allograft acute rejection.
18186794 Observational study of gene-disease association. (HuGE Navigator)
18164036 Increased ICAM-1 expression might be an early factor involved in the pathogenesis of blood brain barrier injury in sepsis.
18160848 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
18057581 No strong relation was found between G241R and K469E polymorphisms and occurrence of coronary artery disease and myocardial infarction in the studied population from Fars province, Iran
18057581 Observational study of gene-disease association. (HuGE Navigator)
18045607 Significant linkage was observed on chromosome 19 (LOD=4.0 at 14cM) in whites near the ICAM gene cluster that includes the structural gene for ICAM-1
18028430 L-selectin is defective in the stem cell compartment of MDS and sAML, whereas ICAM1 is overexpressed; the ratio of their expression has a prognostic role; and a ratio <1 significantly predicts progression to overt leukaemia in MDS patients
17990298 Findings implicate upregulation of ICAM-1 in decidual endothelial cells in the development of placental bed vascular pathology in diabetic pregnancy.
17982228 crude extract of D. farinae induces ICAM-1 expression in EoL-1 cells through signaling pathways involving both NF-kappaB and JNK
17977219 slCAM-1 could be employed as a potential morbidity marker in schistosomiasis mansoni infection.
17974148 study investigated the influence of hepatitis C virus infection on serum profile of sICAM-1 and VEGF in patients with hepatitis C and hepatitis C with superimposed hepatocellular carcinoma
17969524 FasL and ICAM-1 expression in the tonsillar high endothelial venules contribute to idiopathic tonsillar hypertrophy and chronic hypertrophic tonsillitis.
17963163 Increased blood levels in rheumatoid arthritis are diminished after treatment with methotrexate.
17962718 Iron, unlike interferon-gamma, does not appear to be involved in the regulation of ICAM-1 and VCAM-1 expression in cultured endometrial cells.
17962597 Observational study of gene-disease association. (HuGE Navigator)
17962597 Lys56Met and Gly241Arg ICAM-1 gene variants may have a role in cardiovascular events
17956423 This is the first report of a leptospiral protein capable of up-regulating the expression of endothelial cell adhesion molecules ICAM-1 and E-selectin.
17954174 Observational study of gene-disease association. (HuGE Navigator)
17943642 There were no significant differences in the mean serum intercellular cell adhesion molecule 1(ICAM1) concentration of women who developed pereclampsia and unaffected women.
17942534 ps20 promoted HIV entry via fusion and augmented CD54 integrin expression
17913807 Here we demonstrate that leukocyte function-associated antigen 1 (LFA-1), intercellular adhesion molecule 1 (ICAM-1), and ICAM-3 are enriched at the VS and that inhibition of these interactions influences conjugate formation and reduces VS assembly.
17908278 Higher levels of plasma ICAM-1 are associated with primary graft dysfunction following lung transplantation.
17891599 There was no relationship between investigated genotypes or haplotypes of estrogen receptor alpha and levels of sICAM-1 in postmenopausal women.
17885215 s-FKN is shed from endothelial cells following hypoxia/reoxygenation and acts through CX3CR1 on them to increase ICAM-1 expression and promote neutrophil adhesion through activation of the Jak-Stat5 pathway
17875742 These results identify a new signaling pathway involving RhoG and its exchange factor SGEF downstream from ICAM1 that is critical for leukocyte trans-endothelial migration.
17873320 Observational study of gene-disease association. (HuGE Navigator)
17873320 no association of G241R and K469E polymorphisms of the ICAM-1gene with the development of Graves' disease in a Chinese population.
17868277 Observational study of gene-disease association. (HuGE Navigator)
17868277 We concluded that role of the ICAM-1 gene polymorphisms in the pathogenesis of multiple sclerosis is still controversial and should be studied further.
17803991 These results showed that the binding probability and adhesion force of Mac-1 with ICAM-1 increased upon Mac-1 activation.
17786132 Highly active antiretroviral therapy produces downregulation of ICAM-1 expression in HIV-1 infection.
17786132 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
17785844 ICAM-1-mediated signaling regulates proteins of the adherens junctions during transendothelial migration (TEM), signals which are required for facilitating junctional disruption during paracellular passage of leukocytes.
17710630 CD36, ICAM-1, and P-selectin are major contributors to the dynamic process of Plasmodium falciparum-infected red blood cell adhesion by different mechanisms in vivo
17708604 The ICAM-1 positive expression rate in gastric carcinoma was 58%. There was no statistically significant difference between the internal obstruction of stagnant toxin type and the in-coordination between liver and stomach type.
17706953 OPG but not OPN stimulated a dose-dependent increase in the expression of intercellular adhesion molecule-1, vascular cell adhesion molecule-1 and E-selectin by endothelial cells in the presence of TNF-alpha
17706337 In women with subsequent preeclampsia, sL-selectin and sVCAM-1 concentrations were significantly lower, whereas sE-selectin, sP-selectin and sICAM-1 levels were significantly higher, compared with controls at mid-pregnancy (p<0.05).
17704297 Observational study of gene-disease association. (HuGE Navigator)
17704297 Polymorphisms in the exon of ICAM-1 is associated with the development of differentiation syndrome in acute promyelocytic leukemia
17703412 Observational study of gene-disease association. (HuGE Navigator)
17677000 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17657162 Nicotine promotes ICAM1 expression on endothelial cells, shifting them toward a proatherosclerotic state.
17640650 Among women without a history of cardiovascular disease, sICAM-1 levels are predictive of events that reflect coronary atherosclerotic disease progression and vessel narrowing, but not those events associated with acute thrombosis/vessel occlusion
17609265 diminished ability of NK cells to kill HTLV-1-infected cells was the decreased ability of NK cells to adhere to HTLV-1-infected cells because of HTLV-1 p12(I)-mediated down-modulation of intercellular adhesion molecule 1 (ICAM-1) and ICAM-2.
17607549 Hyaluronan of intrinsic molecular weight suppresses LPS-stimulated production of proinflammatory cytokines via ICAM-1 through down-regulation of NF-kappaB and IkappaB
17598660 The study revealed no differences in mean concentration of serum sICAM-1 between patients with seasonal allergic rhinitis and seasonal asthma but significant increase of serum sICAM-1 level during natural allergen exposure in all patients was observed.
17593226 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17593226 ICAM-1 469E polymorphism may contribute to an early age of diagnosis of Crohn's disease.
17591781 the cytoplasmic tail of ICAM-1 regulates leukocyte transmigration through MT1-MMP interaction
17591777 talin induced an intermediate affinity alphaLbeta2 that adhered constitutively to its ligand intercellular adhesion molecule ICAM-1 but not ICAM-3.
17583675 The results show that Hcy activated both ERK(1/2)/p38MAPK pathway and NF-kappaB-DNA-binding activity.
17564956 soluble ICAM-1 levels are a good indicator of neonatal sepsis.
17560459 circulating levels of adhesion molecules in correlated positively with the stage of kidney disease and with C-reactive protein
17551301 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17531998 Patients with primary hypertriglyceridemia as compared with control subjects showed significantly higher plasma ICAM-1 (intercellular adhesion molecule 1)and increases in monocyte and lymphocyte ICAM1 (CD54)
17521325 Observational study of gene-disease association. (HuGE Navigator)
17517105 Cytokine-induced endothelial intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 expressionwas inhibited by tecastemazole in a manner independent of H1 receptor antagonism.
17497038 ICAM-1 levels were positively correlated with TAG and C-reactive protein levels, indicating that increased level of oxidative stress marker, proinflammatory markers, and their downstream effectors adhesion molecules occur in type 2 DM.
17476188 Data show that low-dose irradiation stimulates TNF-alpha-induced ICAM-1 mRNA expression in human coronary vascular cells.
17429072 Data demonstrate that (507)RKIKK(511) is an essential motif for the microvillus ICAM-1 presentation and further suggest a novel regulatory role for ICAM-1 topography in leukocyte transendothelial migration.
17397790 Taken together, these results confirm the role of TNF-alpha and the three adhesion molecules in pathogenic processes associated with severe malaria in children, and suggest an association between sICAM-1 and severe malarial anemia.
17390085 Observational study of gene-disease association. (HuGE Navigator)
17390085 polymorphisms of ICAM1 may confer susceptibility to postmenopausal osteoporosis in women, and that of GJA4 to osteoporosis in men
17389327 higher levels of E-selectin and ICAM-1 were consistently associated with increased diabetes risk in a multiethnic cohort of U.S. postmenopausal women, implicating an etiological role of endothelial dysfunction in the pathogenesis of type 2 diabetes.
17361014 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17340048 ICAM-1 may have a role in inflammation in systemic lupus erythematosus patients with lupus nephritis
17337890 Serum ICAM-1 was higher in patients with breast cancer, and further elevated in the metastatic breast cancer group.
17334226 data indicate that HIV-1 Tat can modulate monocyte adhesiveness by increasing expression of adhesion molecules such as ICAM-1 and VCAM-1 via ROS- and NF-kappaB-dependent mechanisms in astrocytes
17334226 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
17328035 ICAM-1 expression on conjunctival epithelial cells may be a marker of the inflammatory status in cystic fibrosis patients.
17311092 ICAM-1 is mandatory for the NK cell interferon-gamma response. It acts via its engagement with its host ligand, LFA-1, and not with PfEMP1.
17309130 The elevation of plasma levels of sICAM-1 was associated with a status of insulin resistance in patients with SLE
17292586 These findings reveal for the first time that TNF stimulation of adhesion molecules ICAM-1 and VCAM-1 in human endothelial cells occurs through the TNFR1 subtype and is mediated by the NF-kappaB pathway, but not the ERK, p38MAPK or JNK kinase pathways.
17278022 In cultured salivary gland cells from patients with Sjogren's syndrome, CD40-ligand enhances the ICAM-1 expression at mRNA and protein level, by activation of NF-kappaB p50
17255534 ICAM-1 in cooperation with VCAM-1 are essential for monocyte adhesion by carbamylated low-density lipoprotein-activated human vascular endothelial cells in vitro.
17237434 oxidative stress in endothelial cells created by excess of antioxidative agents resulted in the generation of reactive oxygen species, carbonylation and glutathionylation of proteins, inhibition of IKKalpha activity, and up-regulation of ICAM-1
17237399 VEGF was associated with a defect in ICAM-1 and VCAM-1 clustering at the EC surface; overexpression of caveolin-1 overcame the VEGF-mediated inhibition of adhesion and restored ICAM-1 clustering
17195014 Moderately elevated ICAM-1 reduces endothelial cell(EC) barrier function. Expressing higher levels of ICAM-1 affects cell junctions and cytoskeleton. Induction of ICAM-1 may contribute to TNF-induced vascular leak and EC shape change.
17192354 Hemoglobin A1C in diabetics is positively associated with ICAM1 levels.
17190650 Contact activation of the bronchial epithelial cells, involving ICAM-1 via local activation of ERK1/2, is an important mechanism of alteration of the bronchial epithelial permeability.
17184150 Soluble ICAM-1 is responsive to acute psychosocial stress.
17174307 MARCH-IX expression causes ubiquitination and downregulation of ICAM-1
17142773 HOSCN induces E-selectin, ICAM-1, and VCAM-1 expression in HUVEC; HOSCN up-regulation of these adhesion molecules is transcriptionally mediated through a mechanism dependent upon activation of NFKB and constitutively suppressed by PI3K-Akt pathway.
17136392 Elevated plasma ox-LDL and sICAM-1 levels were associated with increased risk of type 2 diabetes.
17126824 vascular cell adhesion molecules (sICAM-1 and sVCAM-1) and also P-selectin were higher in patients than healthy controls
17116732 An ICAM-1-mediated mechanism recruits leukocytes to the lymph nodes during inflammation.
17115895 The present data underscore a novel function for ICAM-1 in modulating GSH metabolism and raise the hypothesis that this adhesion molecule controls endothelial redox status under basal and inflammatory conditions.
17112530 there is significant evidence of locus heterogeneity for sICAM-1 on Chromosome 19 in this sample of Mexican Americans
17090406 high levels of sICAM-1 and sVCAM-1, together with the presence of circulating endothelial cells in dengue hemorrhagic fever patients, provide further evidence of endothelium damage and activation in DHF patients
17089918 Observational study of gene-disease association. (HuGE Navigator)
17089918 The K469E polymorphism of the ICAM-1 gene was not associated with MI in patients with type 2 diabetes.
17083721 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
17082600 ICAM-1 engagement by human rhinovirus and cross-linking antibodies enhances its coassociation with Syk kinase and ezrin in airway epithelium.
17062505 data suggest that induction of ICAM-1 expression by gammaIR is associated with catalase; furthermore, catalase, JNKs, and AP-1 activation induce ICAM-1 upregulation through a sequential process
17056576 Tyrosine phosphorylation of cortactin dynamically links ICAM-1 to the actin cytoskeleton, enabling ICAM-1 to form clusters and facilitate leukocyte transmigration.
17051589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17012367 These data implicate an important role of c-Src in phosphorylating RelA/p65 to promote the transcriptional activity of NF-kappaB and thereby ICAM-1 expression in endothelial cells.
17012252 alpha-synuclein strongly stimulates human alpha-synuclein strongly stimulates human astrocytes as well as human U-373 MG astrocytoma cells to up-regulate both interleukin IL-6 and ICAM-1; mutated forms are more potent stimulators than wild-type
17008592 Stimulation of intercellular adhesion molecule-1 (ICAM-1) was blocked by MG-132.
16978373 Observational study of gene-disease association. (HuGE Navigator)
16970684 Presence of soluble ICAM-1 in the cerebrospinal fluid of children during the early phase of mumps meningitis may be a useful marker of inflammatory responses in the central nervous system.
16963052 Excess body iron, reflected by elevated serum ferritin and non-transferrin bound iron and decreased total iron binding capacity, is associated with increased plasma level of sICAM-1
16951376 Direct interaction of ICAM-1 with cytoplasmic alpha-actinin-1 and -4 is essential for leukocyte extravasation.
16938116 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16938116 IL-6 -634C/G and ICAM-1 469K/E polymorphisms synergistically affect the susceptibility for endometriosis in the Japanese population.
16937502 Observational study of gene-disease association. (HuGE Navigator)
16931899 these studies indicate a control function of the microtubule network on the expression of ICAM-1
16930678 endothelial ICAM-1 function is altered by clonal senescence
16920698 Gastrin-releasing peptide upregulates ICAM-1 via FAK promotes tumor cell motility and attachment to the extracellular matrix.
16920492 Signalling via ICAM-1 induces adhesiveness of mononuclear phagocytes.
16916660 Observational study of genotype prevalence. (HuGE Navigator)
16916657 Observational study of gene-disease association. (HuGE Navigator)
16916657 R241 variant mainly confers predisposition to celiac disease occurring during adulthood.
16914605 H. influenzae infection increases airway epithelial cell ICAM-1 and TLR3 expression, leading to enhanced binding of RV and a potentiation of RV-induced chemokine release
16857989 mutation of the serine phosphorylation site leads to inability of Mac-1 to become activated to bind the cellular ligands ICAM-1 and ICAM-2.
16844085 Small interfering RNAs directed against ICAM-1 restored the homoassociation of MHC-I without influencing the expression level of MHC-I by eliminating ICAM-1 molecules interspersed in MHC-I clusters
16824729 Blood vessels were similarly ICAM-1 immunoreactive, and in some subjects there was a variable number of extravascular patches of ICAM-1-I. The area fraction of ICAM-1-I was higher in the old subjects than in the young subjects.
16820586 Observational study of gene-disease association. (HuGE Navigator)
16773720 Serum E-selectin, ICAM-1 and integrin beta1 expression levels are probably related to the metastasis and relapse of gastric cancer.
16759306 Observational study of gene-disease association. (HuGE Navigator)
16750586 Observational study of gene-disease association. (HuGE Navigator)
16741608 Observational study of gene-disease association. (HuGE Navigator)
16741608 Polymorphism observed in the ICAM-1 gene is not genetic susceptibility factors for Crohn's disease or ulcerative colitis in Turkey.
16733712 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16733712 Results replicate previous findings of association of the ICAM gene cluster with prostate cancer and suggest that common genetic variation within ICAM1 and not ICAM5 may be an important risk factor for prostate cancer.
16705652 allosteric antagonists work by eliminating breathing motion that leads to the open conformation of the I-domain when LFA1 and ICAM1 bind
16680245 Observational study of gene-disease association. (HuGE Navigator)
16625213 Observational study of gene-disease association. (HuGE Navigator)
16625213 The study concludes that K469KE is associated with paediatric asthma in the German population and the same polymorphism is correlated with serum levels of ICAM1.
16622032 support the potential efficacy of an anti-ICAM Ab delivered by lactobacilli for use as an anti-HIV-1 microbicide
16611655 ICAM-1 is expressed in pulmonary fibroblasts of COPD patients
16604499 Observational study of gene-disease association. (HuGE Navigator)
16604496 Observational study of gene-disease association. (HuGE Navigator)
16604055 Higher level of ICAM-1 protein in macular choriocapillaris may impart greater susceptibility of macula to immune cell-mediated damage in age-related macular degeneration.
16570073 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
16512757 Observational study of gene-disease association. (HuGE Navigator)
16507929 The endothelium most likely contributes to increased ICAM-1 in pregnant heavy smokers, but a leukocyte source cannot be ruled out.
16506060 Analysis of lymphocyte subsets showed that the total number of CD3+, CD4+, CD8+ and CD56+ lymphocytes increased after the intensive protocol before falling below pre-exercise values at 1 h post-exercise.
16497620 ICAM-1 expression was related to both the degree and the nature of inflammation, the data indicate increased susceptibility of cancer cells to express ICAM-1.
16492228 Progressive decrease in sICAM-1 levels during attacks by lymphocytes could antagonize their transvascular migration, supporting the hypothesis of sterile inflammation in the dura mater during migraine attacks.
16482425 Immunoreactivity of VEGF, p53 and ICAM-1 was found in epithelial, fibroblast and vascular endothelial cells.
16471223 The coding single nucleotide polymorphism + 13848 A/G in the exon 6 of ICAM-1 gene was associated to myocardial infarction and the allele A might serve as a risk factor for myocardial infarction in Chinese.
16471223 Observational study of gene-disease association. (HuGE Navigator)
16434609 study does not confirm association between ICAM1 K469E polymorphism and breast cancer risk
16432463 Observational study of gene-disease association. (HuGE Navigator)
16432463 Single Nucleotide Polymorphisms in intercellular adhesion molecule-1 is associated with cutaneous melanoma
16429128 The translocation of ICAM-1 to caveola- and F-actin-rich domains links the sequential steps of lymphocyte adhesion and transendothelial migration and facilitates lymphocyte migration through endothelial cells.
16428725 NTHI (Nontypeable Haemophilus influenzae) adhesion to human respiratory epithelial cells occurs through the interaction of P5 fimbriae with its receptor, ICAM-1, and upregulation of ICAM-1 expression.
16426244 Observational study of gene-disease association. (HuGE Navigator)
16426244 These data suggest that the A allele of the ICAM-1 exon 4 polymorphism may protect against the risk of RPS following UTI and may participate in the regulation of the inflammatory response following UTI.
16358956 Increased ICAM-1 levels are associated with type 1 diabetes mellitus
16332693 analysis of how TACE mediates the ectodomain cleavage of ICAM-1
16320110 ICAM-1 can influence the migration of cells that express endogenous or transfected MUC1.
16317091 rhMIF induced VCAM-1 and ICAM-1 up-regulation in 12 hours via Src, PI3K, and NFkappaB
16313300 Observational study of gene-disease association. (HuGE Navigator)
16299052 Cellular elements controlling the uptake and intracellular trafficking of nanocarriers targeted to ICAM-1.
16288711 results suggest that gingival fibroblast are stimulated by monocytes resulting in enhanced expression of MMP-1 and TIMP-1 and that the enhanced MMP-1 expression, in contrast to TIMP-1, is partly mediated by ICAM-1 and the signal pathway p38 MAPK
16272310 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
16270299 Serum levels were measured with enzyme-linked immunosorbent assays over the first 2 years of life in 65 children seroconverting to positivity for autoantibodies and 65 control children, all with susceptibility to type 1 diabetes.
16266408 Observational study of gene-disease association. (HuGE Navigator)
16248457 Serum levels of sICAM-1 in patients with nasal polyps were higher than that of control group.
16184405 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16177322 Pneumolysin from Streptococcus pneumoniae induces transcription and production of ICAM-1
16177300 ICAM-1 and caveolae are required for the invasion of P. gingivalis into human oral epithelial cells.
16158332 ICAM-1 may be involved in the pathogenesis of ulcerative colitis (review)
16152588 both primary and metastatic human uveal melanoma cells express CD54
16122754 The upregulation of ICAM-1 by postprandial LDL may explain part of the proatherogenic effect of high postprandial lipemia.
16100282 biophysical analysis of how lymphocyte function-associated antigen-1 mediates rolling of polystyrene particles on ICAM-1 under flow
16097065 Observational study of gene-disease association. (HuGE Navigator)
16097065 The process is not associated with genetic variation of K469E ICAM-1 polymorphism in biliary atresia.
16043164 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16043164 variant frequencies of ICAM1, APOE, PPARA and PAI-1 genes in coronary artery disease patients and healthy blood donors; specific arrangement of polymorphic variants which differentiate both groups
16041273 Anti-ICAM-1 antibodies are produced after cardiac transplantation, but not to polymorphic residues, which may contribute to the endothelial activation by binding to the endothelium, causing activation of proinflammatory signaling pathways.
16038038 lymphocyte-induced destruction through adhesion by ICAM-1 and binding of LFA-1-expressing activated lymphocytes takes place not only in bile ductules but also in the canal of Hering in biliary cirrhosis
16023325 An inverse relationship is shown for the first time in the ratio between ICAM1-expressing lymphocytes and transforming growth factor (TGF)-beta 1 serum concentrations during the clinical stages of acute rheumatic fever.
16021473 241A and 469G codon variants of intercellular adhesion molecule 1 may indicate haplotypes that are associated with reduced risk for asthma.
16004874 x-ray crystallographic analysis of coxsackievirus A21 and its interaction with ICAM-1
16002039 Observational study of gene-disease association. (HuGE Navigator)
15958383 the hybrid domain of integrin alphaL beta2 has different requirements of affinity states for ICAM-1 and ICAM-3 binding
15958080 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15952122 There is an association between ICAM-1 gene K469E polymorphism and ischemic stroke, and E allele may be a genetic risk factor of IS among Guangxi Zhuangs.
15952122 Observational study of gene-disease association. (HuGE Navigator)
15948767 Cultured endometrial epithelial cells constitutively express significantly more ICAM-1 mRNA and protein than endometrial stromal cells
15919214 describes the responses of sICAM-1 levels to nutrients, physical activity, smoke exposure and alcohol consumption
15917409 Observational study of gene-disease association. (HuGE Navigator)
15914533 Cytokine/thrombin-enhanced DC IL-8 expression interacts with constitutively expressed ICAM-1 in decidual endothelium to modulate neutrophil trafficking into hemorrhagic and inflamed first trimester decidua
15896355 Insulin enhances leukocyte-endothelial cell adhesion in the retinal microcirculation through surface expression of ICAM1.
15886114 productive engagement of ICAM-1 on target cells leads to recruitment of the MHC-I proteins to the contact area and enhances presentation of cognate peptide MHC-I complexes to cytotoxic T cells.
15883744 Retinoic acid inhibits CD40 plus IL-4 mediated IgE production through alterations of sCD23, sCD54 and IL-6 production
15866119 Observational study of gene-disease association. (HuGE Navigator)
15864742 Data suggest that ICAM-1 gene induction by TNFalpha and IL-6 is mediated mainly via NFkappaB and Stat3, respectively and Rac1 appears to play a central role in modulating cytokine-induced ICAM-1 expression in endothelial cells.
15854776 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15853902 Linkage and association studies of ICAM1 in two Senegalese villages located in regions of endemic malaria showed no evidence for a role of ICAM1 variability on the malarial phenotypes studied.
15831709 propose that a positive feedback loop involving ICAM-1 and HTLV-1 Tax protein facilitates the formation of the virologic synapse and contributes to the T-cell tropism of HTLV-1
15817812 FXR-mediated activation of ICAM-1 could be further enhanced by TNF-alpha cotreatment in hepatocytes
15800027 SCF and TNF-alpha acted through ERK and the NF-kappaB pathway to regulate the ICAM-1 expression and elicited the synergistic effect.
15774488 causal role of in invasion of metastatic human breast carcinoma cell lines.
15760456 findings demonstrate that the mature form of Toxoplasma gondii adhesin MIC2 is activated for binding to ICAM-1 on host cells and that this interaction probably facilitates transmigration by the parasite
15756053 Observational study of gene-disease association. (HuGE Navigator)
15756053 We hypothesize that the biochemical effect of the G241A SNP is masked in schizophrenic patients, indicating a disease-related mechanism leading to reduced levels of sICAM-1 in schizophrenia.
15736117 Observational study of gene-disease association. (HuGE Navigator)
15736117 K469E polymorphism of the intercellular adhesion molecule-1 (ICAM-1) gene had impact on plasma fibrinogen level independently of other clinical factors in type 2 diabetic patient
15724813 ICAM-1 has a role in mediating the interaction between the parasitised red blood cell and the vascular endothelium in malaria
15713910 In human renal proximal tubule epithelial cells, CD40 activation upregulates ICAM-1 (and other NF-kappaB pathway genes) expression with concomitant enhanced adhesion of mononuclear cells, which is mediated via the p38 MAPK signal transduction pathway.
15696921 The levels of ICAM-1 and IL-6 in nasal lavage fluid from patients with allergic rhinitis were significantly higher than the controls. ICAM1 and IL6 levels were correlated with pulmonary function.
15682683 Observational study of gene-disease association. (HuGE Navigator)
15682683 ICAM-1 variants may modulate atherosclerosis in humans. Inflammatory gene polymorphisms may influence atherosclerosis independent of plasma levels of their gene products.
15666579 Direct implication of adhesion molecules in the pathogenesis or progression of type 2 diabetic retinopathy cannot be supported.
15665526 ICAM-1 in oral keratinocytes may have an immunostimulatory role in oral muocsa and skin
15654951 PAR2 induces upregulation of cell adhesion molecules such as ICAM-1 in primary human keratinocytes via NF-kappaB activation
15650392 NF-kappaB appears crucial in ICAM-1 induction, but p38 activation itself is not sufficient to confer HO-1 expression and may not be involved in HO-1 and ICAM-1 induction in human tumor cells
15611342 The Binding of monomeric intercellular adhesion molecule-1 (ICAM-1) induced profound changes in the conformation of LFA-1 but did not alter clustering, whereas binding of ICAM-1 oligomers induced significant microclustering.
15607204 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15607204 this risk increased elevenfold with the simultaneous presence of the intercellular adhesion molecule-1 (ICAM-1: E469K) KK genotype for multiple system atrophy.
15593054 In myeloperoxidase-ANCA-positive microscopic polyangiitis, higher sICAM-1 and sELAM-1 levels during active phase and their slower decline during treatment period could be prognostic risk factor for chronic renal failure.
15583842 ICAM-1 molecules interacted only with (group B Streptococcus)GBS-III liquor 90356 strain while beta1 integrin interacted with GBS-III liquor 90356 and GBS-V blood 90186 invasive strains
15560890 Cell expression in response to tobacco smoke extract.
15550998 role in increased adhesiveness of circulating leukocytes in the pathogenesis of ulcerative colitis
15548573 The ICAM-1 is key molecule in immune-mediated and inflammatory processes and are thus critically involved in diverse clinical disorders, ranging from asthma to atherosclerosis.
15545280 N-Linked glycosylation regulate both conformation and immune related functions of ICAM receptors
15479832 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
15448102 ICAM-1 expression may share common genetic modulation with traits related to obesity, insulin resistance, and HDL3 cholesterol.
15389590 Persistent cAMP elevation activating PKA is able to enhance ICAM-1 expression at cell surface of endothelial cells under pro-inflammatory conditions. Combination of activation of gene transcription and membrane targeting may account for this augmentation.
15387368 results pinpoint ICAM-1 for the first time as a molecule crucially involved in small cell lung carcinoma cell-endothelial adhesion
15379751 In an Irish population, the ICAM-1 K469E polymorphism is not associated with ishemic heart disease.
15361125 Observational study of gene-disease association. (HuGE Navigator)
15353596 transgenic mice were made that express human intercellular adhesion molecule 1, the cell-surface receptor for Coxsackievirus A21; CAV21 administered to these mice via the intramuscular route causes a paralytic condition consistent with poliomyelitis
15334773 Observational study of gene-disease association. (HuGE Navigator)
15334673 The expression of ICAM-1 in lymphatic vessels is beneficial to the judgement of the invasion and metastasis ability of colon cancer.
15331736 A naturally occurring variant of ICAM-1, ICAM-1Kilifi, has altered binding characteristics with respect to different human rhinovirus serotypes.
15331359 Clustered monocyte cell adhesion correlated with endothelial cells coexpressing intercellular adhesion molecule-1 (ICAM-1) and E-selectin as result of a flow-induced, selective upregulation of E-selectin expression in a subset of ICAM-1-expressing cells.
15313174 Hypoxia alone did not increase either ROS production or ICAM-1 mRNA levels, but a 2.5-fold increase in ICAM-1 mRNA was noted by 30 min of reoxygenation.
15308783 Observational study of gene-disease association. (HuGE Navigator)
15304054 ICAM-1, VCAM-1, E-selectin and interleukin-6 expression are enhanced by glucose and regulated by poly(ADP-ribose) polymerase in human umbilical endothelial cells
15294853 LPA and S-1-P enhance ICAM-1 expression at both the mRNA and protein levels in human umbilical cord vein endothelial cells
15290909 Observational study of gene-disease association. (HuGE Navigator)
15290909 These data support linkage for Crohn's disease at 19p13 and suggest that the amino acid polymorphisms in ICAM-1 may be associated with IBD.
15279951 findings help clarify the essential requirements for Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) binding to ICAM-1
15272865 the specific CD23-engagement on lung endothelial cells cells induced a significant decrease in ICAM-1 expression, an adhesion molecule implicated in Plasmodium falciparum parasitized red blood cell cytoadherence
15246972 cAMP concentration in endothelial cells prevents thrombin-induced ICAM-1 expression by inhibiting p38 MAPK activation, which in turn prevents phosphorylation of RelA/p65 and transcriptional activity of the bound NF-kappaB.
15221034 mean serum level of soluble ICAM-1 in bronchiolitis patients was significantly higher than in the 10 healthy control infants (345.8 +/- 99.7 microg/mL vs 237.1 +/- 81.7 microg/mL; p<0.05).
15212674 The ICAM-1 expression in visually normal peritoneal cells from women with endometriosis may play a role in the early implantation of peritoneal endometriosis.
15210758 immature DCs owe part of their outstanding Ag-independent T cell stimulatory ability to chemokines and ICAM-1, but not DC-specific ICAM-3-grabbing nonintegrin.
15208262 The ICAM-1/LFA-1 association was a more efficient transmission factor for HIV-1 bearing ICAM-1 than combined gp120/DC-SIGN & ICAM-3/DC-SIGN. The involvement of virus-bound ICAM-1 & LFA-1 in virus binding & carriage was confirmed in human lymphoid tissues.
15208262 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
15183063 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
15169768 Data show that MUC1 mucin expressed on the surface of cells can initiate a calcium-based oscillatory signal on contact with intercellular adhesion molecule (ICAM)-1-transfected cells.
15140794 Cytomegalovirus IE proteins stimulate ICAM-1 expression on villous trophoblasts by paracrine release of TNF alpha and IL1 beta, as well as by a direct effect on infected cells.
15123348 Observational study of gene-disease association. (HuGE Navigator)
15123348 E469E homozygote status for ICAM-1 is associated with protection against primary sclerosing cholangitis.
15094060 sICAM-1 was processed distal to Arg441, indicating that MMP-9, docking to ICAM-1, contributes to sICAM-1 shedding and attenuation of the shear stress-induced upregulation of ICAM-1.
15081401 1548 polymorphism modifies inflammatory immune responses by changing cell-cell interaction and then regulating apoptosis
15080580 intercellular adhesion molecule-1 may play an important inflammation-related role in plaque development.
15059493 Intercellular adhesion molecule 1 may play a role in asthma.
15057477 Live Porphyromonas gingivalis enhanced the expression of intercellular adhesion molecule-1 (ICAM-1) on the surface of human umbilical vein endothelial cells (HUVECs) in a bacterial dose-dependent manner.
15048650 Observational study of gene-disease association. (HuGE Navigator)
15048650 Our study in the Spanish population argues against the hypothesis that polymorphism at codon 469 of the ICAM-1 gene is causally related to Alzheimer's disease.
15013836 Intercellular adhesion molecule-1 immunoreactivity in gray and white matter of the ACC in bipolar subjects was increased compared with control subjects (gray: p =.001; white: p <.001) and schizophrenic subjects (gray: p =.016; white: p =.025)
15009098 Expresson is reduced in treatment with methotrexate in bullous pemphigoid.
14993495 In patients on continuous ambulatory peritoneal dialysis, carotid atherosclerosis is associated with markers of inflammation, malnutrition and circulating levels of adhesion molecule ICAM-1.
14984317 even a short-term exposure of endothelial cells (ECs) to high glucose concentration leads to their activation associated with increased expression of adhesion molecules such as ELAM-1, VCAM-1 and ICAM-1.
14975197 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14763979 Mutagenesis of domain 1 of ICAM-1 shows that the binding sites for different Plasmodium falciparum variants overlap to a large extent, but that there are subtle differences between them that correlate with their adhesive phenotypes.
14763917 Data indicate that weight loss is more important than glycaemic control in regulating circulating levels of ICAM-1 in morbidly obese subjects.
14742996 beta2-AR agonists strongly inhibited the expression of ICAM-1 and CD40.
14741380 study demonstrates that overexpression of RORalpha1 and RORalpha4 inhibits TNF-alpha induced expression of VCAM-1 and ICAM-1 in human umbilical vein endothelial cells by inhibiting the NF-B signaling pathway
14737745 positive marker for precinical type 1 diabetes in children
14734737 Basal expression and colocalization of ICAM-1 with E-selectin and CCL17 chemokine in dermal vessels serves to recruit T cells to noninflamed human skin and provides a strong cutaneous immunosurveillance system and model interface with the environment.
14722298 community-circulating strains of Coxsackie virus A21 can infect target cells expressing either ICAM-1 or decay-accelerating factor alone and that such interactions extend tissue tropism and impact directly on viral pathogenesis.
14714557 minor trauma to skin may induce expression of E-selectin, ICAM-1 and IL-8
14695458 Increased expression of ICAM1 may affect the development of initial atherosclerotic coronary stenosis, but not re-stenosis.
14691297 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
14643123 Our data indicate an aetiological role for ICAM-1 in type 1 diabetes, which needs to be confirmed in future genetic and functional experiments.
14634129 Vascular endothelium generates microfilament-, microtubule-, and calcium-dependent ICAM-1-enriched-cup-like structures within minutes of binding in vitro to lymphocyte function-associated antigen-1 (LFA-1)-bearing leukocytes.
14609725 intercellular adhesion molecule 1 expression was enhanced in the macrophage-derived foam cells
14605444 findings indicate that cytochalasin E activates protein kinase C under the depolymerization of actin filament, leading to the induction of interleukin-8 production and the up-regulation of CD54 in HeLa cells
14581566 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
14572618 TNFalpha stimulates binding of nuclear proteins to the nuclear factor kappa beta (NFkappaB) and the CAAT/enhancer binding protein (C/EBP) consensus sites in the ICAM-1 promoter in these cells
14572449 ICAM-1 protein is selectively expressed in cortical tubers, but is only minimally expressed in control cortex, adjacent nontuberal cortex of the tuberous sclerosis complex.
14557478 Observational study of gene-disease association. (HuGE Navigator)
14557478 polymorphism at position c.721G-->A is associated with an earlier age of GD onset and that the c.1405A-->G polymorphism of the ICAM-1 gene could predispose to Graves' ophthalmopathy
14551606 ICAM-1 is a protective haplotype against multiple sclerosis.
14550782 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
14534081 Adrenomedullin and ACTH induce cell surface expression of adhesion molecules E-selectin, VCAM-1, and ICAM-1 on human umbilical vein endothelial cells.
14533030 Pterygium epithelium also seems to participate actively in the augmentation of this inflammatory process by expressing ICAM-1 and HLA-DR molecules.
14504278 ICAM-1 has a role in SRC tyrosine kinase activation in pulmonary microvascular endothelial cells
12958678 ICAM-1 plays a role in tumor-mesothelial interactions under steady-state conditions. Tumor-cell binding to a mesothelial monolayer was associated with increased expression of mesothelial ICAM-1 mediated by nuclear factor kappa-B.
12954625 ICAM1 and RANKL are induced by Beta1 integrin/focal adhesion kinase on osteoblasts and in osteoclast maturation
12946329 findings show that infection of bronchial epithelial cells by B. pertussis induces the degradation of IkappaBalpha and the subsequent activation of NF-kappaB, which in turn up-regulates ICAM-1 gene and protein expression
12940514 Blood levels do not differ in normal and coronary artery disease patients
12939654 Observational study of gene-disease association. (HuGE Navigator)
12918698 Polymorphism in this gene is associated with susceptibility to ocular lesions and vasculitis in Korean patients with Behcet's disease.
12915579 infection with Kaposi's sarcoma-associated herpesvirus leads to the downregulation of MHC class I, CD31 (PE-CAM), and CD54 (ICAM-I)
12902516 The presence of the cytoplasmic domain of ICAM-1 is essential for transendothelial migration of T lymphocytes as well as ICAM-1-mediated signaling and ICAM-1-mediated activation of Rho GTPase.
12871600 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
12853962 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
12829919 effect of PGE2 on the expression of ICAM-1 and B7 in the human mixed leukocyte reaction in the presence or absence of IL-18
12808331 Observational study of gene-disease association. (HuGE Navigator)
12808331 ICAM1 mutation is associated with BD susceptibility, and is another genetic risk factor for BD among the Korean population.
12798307 combined use of a vector driving the expression of OX40L with three other costimulatory molecules (B7-1, ICAM-1, and LFA-3) both enhances initial activation and then further potentiates sustained activation of nai;ve and effector T cells.
12788528 Extravasated and oxidized LDL in xanthoma adds to foam cell recruitment by activating tyrosine kinase and inducing adhesion of monocytes to dermal microvascular endothelial cells through VCAM-1 and E-selectin.
12783123 demonstrated that bladder tumor cells express ICAM-1, and that this expression induces a fibrinogen-mediated migration and that ICAM-1/fibrinogen interaction is involved in the extravasation process.
12783117 In pregnant subjects, a positive correlation between monocyte ICAM-1 expression and a number of markers of vascular/thrombotic disease was observed, and also a significant relationship between monocyte ICAM-1 expression and soluble plasma ICAM-1 levels
12775419 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
12768436 Observational study of genotype prevalence. (HuGE Navigator)
12745437 IFNbeta-1a is strong regulator of ICAM 1 RNA splicing. IFNbeta-1a over-expression of ICAM 1 isoforms might have an immunoregulatory role in multiple sclerosis.
12716892 the interaction of CD98/LAT2 with ICAM-1, found to be expressed to the basolateral domain, and the potential of such interaction on intracellular signal activation in Caco2-BBE cell monolayers
12715098 A developing and intensive airway inflammation correlates closely with a persistent expression of ICAM-1 and repeated activation of NF-kappaB.
12714566 Chlamydophila pneumoniae-induced ICAM-1 expression in HAECs requires NF-kappaB and PKC activation and NF-kappaB activation is PKC dependent
12714373 Exposure of epithelial monolayers to the combination of cigarette smoke followed by C5a results in an additive response for ICAM-1 expression and mononuclear cell adhesion compared with smoke or C5a challenge alone
12673844 Endothelial cells have increased expression of VCAM-1, E-selectin, and ICAM-1 when exposed to sickle blood cells.
12660796 Observational study of gene-disease association. (HuGE Navigator)
12660163 activation of expression by p53
12645577 ICAM-1 is induced by TNFalpha in a process that involves IKKbeta
12637697 Synergistic effect of a polymorphism of interleukin-6 gene and 469 E/K polymorphism of the intercellular adhesion molecule-1 gene in Italian patients with history of ischemic stroke.
12624779 Expression of CD40, CD54 and HLA-DR were seen in the hair structure including the dermal papilla in alopecia areata.
12600815 the expression of ICAM-1 might involve both p38 MAPK and NF-kappaB activities, whereas the regulation of CD11b, CD18, and ICAM-3 expressions might be mediated through p38 MAPK but not NF-kappaB.
12595908 Observational study of gene-disease association. (HuGE Navigator)
12590979 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
12533701 findings demonstrate that the cytomegalovirus transactivators IE2p86 and pp71 are crucial regulatory factors for human cytomegalovirus-induced ICAM-1 upregulation
12530121 serum levels elevated in asthmatic patients during acute attack
12529420 Observational study of gene-disease association. (HuGE Navigator)
12529420 the potential associations of ICAM-1 gene polymorphisms with endometriosis and its severity
12524171 Observational study of genetic testing. (HuGE Navigator)
12509902 The detection of serum sICAM-1 will be helpful in estimating the clinical severity of cerebral infarction.
12506144 AP-1 activation calcium-dependent, suggesting the central involvement of this transcription factor in ICAM-1 and RANTES induction after the ligation of ICAM-1.
12498973 Observational study of gene-disease association. (HuGE Navigator)
12498973 polymorphisms of the ICAM-1 gene may be clinically important and confirming that inflammatory mechanisms may be crucial in the pathophysiology of neuro-degenerative diseases.
12496412 Expression of ICAM-1 is sufficient to initiate a signal-dependent adhesion of resting NK cells which can be greatly enhanced either by a pulse of IL-2 or IL-15, or by coexpression of LFA-3 or CD48 with ICAM-1, even in the absence of cytokines.
12480084 expressed in CSF of children with bacterial or viral meningitis
12477764 Observational study of gene-disease association. (HuGE Navigator)
12402194 expression elicited by choline-binding protein A of Streptococcus pneumoniae in alveolar epithelial cells
12393699 Observational study of gene-disease association. (HuGE Navigator)
12391099 Circulating ICAM-1, IL-8, and MCP-1 in untreated obstructive sleep apnea were significantly greater than in controls. nCPAP therapy could reduce OSAS-induced hypoxia and generation of inflammatory mediators.
12370391 ICAM-1 expression cooperatively facilitates L-selectin-mediated rolling of lymphocytes and neutrophils under physiologic shear flow.
12368450 Increased expression in Mycobacterium tuberculosis-infected human macrophages exhibiting enhanced cellular adhesion
12220988 B. pertussis FHA up-regulates ICAM-1 expression on respiratory epithelial cells through interaction of its RGD site with host cell VLA-5 integrin, and that PT impairs this response
12207164 may play a role in the development of nephropathy in patients with type 2 diabetes mellitus
12192299 Observational study of gene-disease association. (HuGE Navigator)
12181421 Depletion of intracellular GTP results in nuclear factor-kappaB activation and intercellular adhesion molecule-1 expression in human endothelial cells.
12175089 Serum levels of soluble intercellular adhesion molecule-1 (sICAM-1), ceruloplasmin (Cp), and transferrin (Tf) in rheumatoid arthritis. Serum Tf levels were significantly diminished and serum levels of sICAM-1 and Cp were significantly increased.
12172576 Downregulation of icam-1 is associated with nodal metastasis in breast cancer
12172318 E-selectin, intercellular adhesion molecule-1 (ICAM-1), and vascular adhesion molecule-1 (VCAM-1) were measured in serum from hypertensive patients with LV hypertrophy
12147222 modulation of expression in endothelial cells by glucosyltransfease inhibitor
12127369 Observational study of gene-disease association. (HuGE Navigator)
12127369 The TT and TC genotype of the ICAM-1 gene polymorphism in codon 469 is a genetic factor that may determine an individual's susceptibility for CHD and MI.
12117984 infection with cagA+ Helicobacter pylori induces homotypic aggregation of macrophage-like cell by up-regulation and recruitment of intracellular adhesion molecule 1 to the cell surface and mediates the aggregation via LFA-1
12097820 ICAM-1/beta2 integrin interactions mediate monocyte adhesion to human saphenous vein
12097408 In endothelial cells, ICAM-1 stimulates c-fos and rhoA transcription and up-regulates rhoA expression by a positive feedback pathway after RhoA activation.
12095649 Observational study of gene-disease association. (HuGE Navigator)
12095649 that genetic polymorphisms of ICAM-1 might be clinically important in the development and progression of neurodegenerative diseases
12086338 the preferential expression of ICAM-1 on the endothelium of femoral and iliac arteries in thromboangiitis obliterans
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12082081 During leukocyte adhesion VCAM-1, ICAM-1, and activated moesin and ezrin clustered in an endothelial actin-rich docking structure that anchored and partially embraced the leukocyte containing other cytoskeletal components
12039084 pregnancy-induced hypertension is accompanied by overexpression of intercellular adhesion molecule-1 (ICAM-1) on peripheral blood and decidual lymphocytes studied "in vitro"
12027924 Observational study of gene-disease association. (HuGE Navigator)
12027924 polymorphism is associated with diabetic retinopathy in type 2 diabetes mellitus
12020443 X-ray doses of < or =5 Gy did not induce ICAM-1 expression, or modulate TNFalpha-induced ICAM-1 expression.
12011765 Blood levels of ICAM1 are low in non-Hodgkin's lymphoma patients
11983194 Prolonged, low dose alpha-tocopherol therapy counteracts intercellular cell adhesion molecule-1 activation
11963839 women with stage III and IV endometriosis had higher serum concentrations of soluble VCAM-1, lower serum concentration of soluble ICAM-1
11956618 expression of ICAM1 in colorectal cancer
11953106 CD54 may play an important role in pathogenic process (in COPD)
11936473 colocalization of ICAM-1 and B7.1 molecules was demonstrated in Hashomoto's thyroiditis whereas no B7.1 expression was observed in Graves' disease
11935152 Relation between glycemic control, hyperinsulinaemia and plasma concentration in patients with glucose intolerance or niddm
11929876 Dynamic regulation of LFA-1 activation and neutrophil arrest on intercellular adhesion molecule 1 in shear flow
11922919 Elevated soluble CD40 ligand is related to the endothelial adhesion molecules in patients with acute coronary syndrome.
11914659 raised sICAM-1 in breast cancer, like the acute phase response, reflects inflammation
11911111 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11911111 Intercellular adhesion molecule-1 gene polymorphisms in isolated polymyalgia rheumatica.
11896203 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
11893710 Observational study of gene-disease association. (HuGE Navigator)
11881155 ICAM-1 participated in cell attachment to X- and Y-fragments, rather than to intact fibrinogen or late degradation products, fragments D and E.
11877286 oncogenic transformation by BCR-ABL may increase susceptibility of leukemic progenitors to NK cell cytotoxicity by a mechanism involving overexpression of ICAM-1
11847011 significant increase in plasma levels between day 1 and day 5 of G-CSF-induced stem cell mobilization; possible effect on leukocyte-endothelial cell interactions
11838958 Down-regulation of cell adhesion molecules LFA-1 and ICAM-1 after in vitro treatment with the anti-TNF-alpha agent thalidomide.
11837795 heat shock decreases endothelial cell ICAM-1 expression via inhibition of IKK activity
11831864 Incubation of endothelial cells with conditioned media derived from stimulated macrophages modulates ICAM1 mRNA expression. Results suggest TNF-alpha and activation of the NF-kB pathway are involved.
11831440 Transient exposure of human bronchial epithelial cells to cytokines IFNG and TNFA, but not IL1B, leads to persistent increased expression of ICAM-1.
11817671 Role of ICAM-1 in the aggregation and adhesion of human alveolar macrophages in response to TNF-alpha and INF-gamma.
11776680 Premature labor is associated with up-regulation of adhesion molecules in the lower uterine segment
11751911 IFN-gamma activates PLC-gamma2 via an upstream tyrosine kinase to induce activation of PKC-alpha and c-Src or Lyn, resulting in activation of STAT1alpha, and GAS in the ICAM-1 promoter, followed by initiation of ICAM-1 expression and monocyte adhesion.
11726228 Observational study of gene-disease association. (HuGE Navigator)
11716965 A defective expression of ICAM-1 (CD54) on secretory endometrial cells is associated with endometriosis.
11517385 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
11508575 Observational study of gene-disease association. (HuGE Navigator)
11469468 Observational study of gene-disease association. (HuGE Navigator)
11409120 Observational study of gene-disease association. (HuGE Navigator)
11361181 Observational study of gene-disease association. (HuGE Navigator)
11354638 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11250042 Observational study of gene-disease association. (HuGE Navigator)
11072593 Observational study of gene-disease association. (HuGE Navigator)
10602408 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
10477700 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
9865497 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
9792375 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
9269771 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
8568270 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
8558011 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
8450224 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
8086129 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
7917519 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
7913356 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
7904170 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells
7794538 HIV-1 Tat upregulates ICAM1 protein expression in hCMEC/D3 cells

AA Sequence

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL      1 - 70
LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG     71 - 140
APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ    141 - 210
TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA    211 - 280
EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL    281 - 350
GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ    351 - 420
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAA    421 - 490
VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP                                491 - 532
//

Text Mined References (991)

PMID Year Title
26943967 2016 Association of ICAM-1 (K469E) and MCP-1 -2518 A>G gene polymorphism with brain abscess.
26897511 2016 Association of Polymorphisms in Intercellular Adhesion Molecule 1 (ICAM-1) Gene with Cancer Susceptibility: A Meta-Analysis of 14 Case-Control Studies.
26872904 2016 High-density lipoprotein of patients with breast cancer complicated with type 2 diabetes mellitus promotes cancer cells adhesion to vascular endothelium via ICAM-1 and VCAM-1 upregulation.
26852488 2015 [Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria].
26847082 2016 Establishment and characterization of a metastasis model of human gastric cancer in nude mice.
26841644 [Adhesion molecules and mononuclear cell subpopulations in the coronary and pulmonary arteries of patients with coronary heart disease].
26773775 2016 Association between 25-hydroxyvitamin D and inflammatory biomarker levels in a cross-sectional population-based study, São Paulo, Brazil.
26751847 2016 Downregulation of human intercellular adhesion molecule-1 attenuates the metastatic ability in human breast cancer cell lines.
26679764 2016 Role of sICAM-1 and sVCAM-1 as biomarkers in early and late stages of schizophrenia.
26648165 2016 Intrinsic effects of gold nanoparticles on proliferation and invasion activity in SGC-7901 cells.
26634518 2015 Association of polymorphism in ICAM-1 (K469E) and cytology parameters in patients' initial blood test with acute ischemic stroke.
26625754 2015 Immunohistochemical Evaluation of Angiogenesis Related Markers in Pyogenic Granuloma of Gingiva.
26571024 2015 ICAM1 Is a Potential Cancer Stem Cell Marker of Esophageal Squamous Cell Carcinoma.
26499045 2016 ICAM-1 regulates the survival of influenza virus in lung epithelial cells during the early stages of infection.
26498675 2016 Association of TLR2 S450S and ICAM1 K469E polymorphisms with polycystic ovary syndrome (PCOS) and obesity.
26413796 2015 Ultraviolet light-emitting-diode irradiation inhibits TNF-? and IFN-?-induced expression of ICAM-1 and STAT1 phosphorylation in human keratinocytes.
26397390 2015 ABL-N may induce apoptosis of human prostate cancer cells through suppression of KLF5, ICAM-1 and Stat5b, and upregulation of Bax/Bcl-2 ratio: An in vitro and in vivo study.
26377944 2015 Relationship between soluble intercellular adhesion molecules and attention-deficit/hyperactivity disorder.
26345838 2015 Role of inflammatory responses in the pathogenesis of human cerebral aneurysm.
26299331 2015 LPS Up-Regulates ICAM-1 Expression in Breast Cancer Cells by Stimulating a MyD88-BLT2-ERK-Linked Cascade, Which Promotes Adhesion to Monocytes.
26276826 2015 Leptin enhances ICAM-1 expression, induces migration and cytokine synthesis, and prolongs survival of human airway epithelial cells.
26271977 2015 [Down-regulation of human intercellular adhesion molecule-1 expression in MCF-7 cells infected by lentiviral short hairpin RNA interference vectors].
26255081 Genetic, epigenetic and protein analyses of intercellular adhesion molecule 1 in Malaysian subjects with type 2 diabetes and diabetic nephropathy.
26231039 2015 Contact-dependent carcinoma aggregate dispersion by M2a macrophages via ICAM-1 and ?2 integrin interactions.
26216937 2015 Neutrophils rapidly transit inflamed lymphatic vessel endothelium via integrin-dependent proteolysis and lipoxin-induced junctional retraction.
26216891 2015 IL-18 Is Involved in Eosinophil-Mediated Tumoricidal Activity against a Colon Carcinoma Cell Line by Upregulating LFA-1 and ICAM-1.
26185364 2015 Epithelium-Specific Ets-Like Transcription Factor 1, ESE-1, Regulates ICAM-1 Expression in Cultured Lung Epithelial Cell Lines.
26177712 2016 Tumor Necrosis Factor-Alpha Up-Regulates ICAM-1 Expression and Release in Intestinal Myofibroblasts by Redox-Dependent and -Independent Mechanisms.
26116870 2015 Circulating endothelial cell number and markers of endothelial dysfunction in previously preeclamptic women.
26109813 2015 High level of intercellular adhesion molecule-1 affects prognosis of patients with hepatocellular carcinoma.
26088024 2015 Extracellular Uridine Triphosphate and Adenosine Triphosphate Attenuate Endothelial Inflammation through miR-22-Mediated ICAM-1 Inhibition.
26081516 2015 Endothelial microparticles reduce ICAM-1 expression in a microRNA-222-dependent mechanism.
26078712 2015 Impact of Intercellular Adhesion Molecule-1 Genetic Polymorphisms on Coronary Artery Disease Susceptibility in Taiwanese Subjects.
25994120 2015 The impact of selectins on mortality in stable carotid atherosclerosis.
25990052 2015 Effect of uncontrolled hyperglycemia on levels of adhesion molecules in patients with diabetes mellitus type 2.
25972323 2015 Osteopontin Regulates VEGFA and ICAM-1 mRNA Expression in Breast Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25942347 2015 The polymorphisms K469E and G261R of intercellular adhesion molecule-1 and susceptibility to inflammatory bowel disease: a meta-analysis.
25896473 CTLA4-Ig/CD86 interactions in cultured human endothelial cells: effects on VEGFR-2 and ICAM1 expression.
25884075 2014 [The level of expression of molecules of adhesion on monocytes depending on morphological differentiation of nuclei].
25859827 2015 Association of the intercellular adhesion molecule-1 (ICAM-1) gene polymorphisms with endometriosis: a systematic review and meta-analysis.
25857767 2015 Vascular cell adhesion molecule-1, but not intercellular adhesion molecule-1, is associated with diabetic kidney disease in Asians with type 2 diabetes.
25784313 Circulating adhesion molecules and arterial stiffness.
25712667 2015 The effect of interleukin-35 on the integrity, ICAM-1 expression and apoptosis of human aortic smooth muscle cells.
25654110 2015 Regulation of ICAM-1 in cells of the monocyte/macrophage system in microgravity.
25653483 2015 Serum levels of IL-8 and ICAM-1 as biomarkers for progressive massive fibrosis in coal workers' pneumoconiosis.
25596452 2015 The role of fractalkine (CX3CL1) in regulation of CD4(+) cell migration to the central nervous system in patients with relapsing-remitting multiple sclerosis.
25586702 2015 Host ICAMs play a role in cell invasion by Mycobacterium tuberculosis and Plasmodium falciparum.
25573100 2015 Intercellular adhesion molecule-1 expression in activated eosinophils is associated with mucosal remodeling in nasal polyps.
25503951 2014 Intercellular adhesion molecule-1 K469E polymorphism and risk of coronary artery disease: a meta-analysis.
25495610 2015 Inflammation markers and their trajectories after deep vein thrombosis in relation to risk of post-thrombotic syndrome.
25454473 2014 ICAM-1 expression on immune cells in chronic villitis.
25450269 2014 The clinical value of lymphatic vessel density, intercellular adhesion molecule 1 and vascular cell adhesion molecule 1 expression in patients with oral tongue squamous cell carcinoma.
25445193 2015 Social defeat promotes a reactive endothelium in a brain region-dependent manner with increased expression of key adhesion molecules, selectins and chemokines associated with the recruitment of myeloid cells to the brain.
25427141 2015 The physiological roles of ICAM-1 and ICAM-2 in neutrophil migration into tissues.
25361845 2015 Mutant KRAS-induced expression of ICAM-1 in pancreatic acinar cells causes attraction of macrophages to expedite the formation of precancerous lesions.
25360558 2014 An analysis of the binding characteristics of a panel of recently selected ICAM-1 binding Plasmodium falciparum patient isolates.
25358349 2014 Elevated levels of serum sICAM-1 in asphyxiated low birth weight newborns.
25324196 2014 Genetic variants in ICAM1, PPARGC1A and MTHFR are potentially associated with different phenotypes of diabetic retinopathy.
25320314 2015 Selective acquisition of host-derived ICAM-1 by HIV-1 is a matrix-dependent process.
25316052 2015 Evaluation in pre-diagnosis samples discounts ICAM-1 and TIMP-1 as biomarkers for earlier diagnosis of pancreatic cancer.
25310099 2014 Association between the polymorphisms in intercellular adhesion molecule-1 and the risk of coronary atherosclerosis: a case-controlled study.
25306212 Secondhand smoke exposure and endothelial stress in children and adolescents.
25287126 2014 Study of the association of adrenomedullin and basic-fibroblast growth factors with the peripheral arterial blood flow and endothelial dysfunction biomarkers in type 2 diabetic patients with peripheral vascular insufficiency.
25283845 2015 Transcriptomic profiling of human choriodecidua during term labor: inflammation as a key driver of labor.
25267626 2014 ICAM-1 as a molecular target for triple negative breast cancer.
25251368 2014 Family with sequence similarity 5, member C (FAM5C) increases leukocyte adhesion molecules in vascular endothelial cells: implication in vascular inflammation.
25245399 2014 MIP-1? enhances Jurkat cell transendothelial migration by up-regulating endothelial adhesion molecules VCAM-1 and ICAM-1.
25201247 2015 Palmitate-stimulated monocytes induce adhesion molecule expression in endothelial cells via IL-1 signaling pathway.
25179218 2014 TNF-? augmented Porphyromonas gingivalis invasion in human gingival epithelial cells through Rab5 and ICAM-1.
25172543 2015 Increased circulating PEDF and low sICAM-1 are associated with sickle cell retinopathy.
25156105 2014 Cytoadherence phenotype of Plasmodium falciparum-infected erythrocytes is associated with specific pfemp-1 expression in parasites from children with cerebral malaria.
25145994 2014 Associations of a polymorphism in the intercellular adhesion molecule-1 (ICAM1) gene and ICAM1 serum levels with migraine in a Chinese Han population.
25138157 2014 Melanoma upregulates ICAM-1 expression on endothelial cells through engagement of tumor CD44 with endothelial E-selectin and activation of a PKC?-p38-SP-1 pathway.
25128351 2014 Association of ICAM-1 K469E polymorphism with neurocysticercosis.
25069049 2014 Cannabinoids increase lung cancer cell lysis by lymphokine-activated killer cells via upregulation of ICAM-1.
25045892 2014 Reduction of adhesion molecule production and alteration of eNOS and endothelin-1 mRNA expression in endothelium by Euphorbia hirta L. through its beneficial ?-amyrin molecule.
25038453 2014 CNOT7/hCAF1 is involved in ICAM-1 and IL-8 regulation by tristetraprolin.
25034460 2014 Evaluation and analysis of plasma soluble adhesion molecules in patients with coronary ectasia and atherosclerotic coronary artery disease.
25032222 2014 Silibinin inhibits ICAM-1 expression via regulation of N-linked and O-linked glycosylation in ARPE-19 cells.
25025994 2014 The ICAM-1 K469E polymorphism is associated with the risk of coronary artery disease: a meta-analysis.
25003170 2014 Interaction of intercellular adhesion molecule 1 (ICAM1) polymorphisms and environmental tobacco smoke on childhood asthma.
24993975 2014 Association of intercellular adhesion molecule?1 gene polymorphism with coronary heart disease.
24979620 2014 SAOS-2 osteosarcoma cells bind fibroblasts via ICAM-1 and this is increased by tumour necrosis factor-?.
24945611 2014 Priming by chemokines restricts lateral mobility of the adhesion receptor LFA-1 and restores adhesion to ICAM-1 nano-aggregates on human mature dendritic cells.
24942509 2014 Intercellular adhesion molecule-1 K469E and angiotensinogen T207M polymorphisms in coronary slow flow.
24940033 2014 TNF-?-induced ICAM-1 expression and monocyte adhesion in human RPE cells is mediated in part through autocrine VEGF stimulation.
24857933 2014 Atomic force microscopy reveals a role for endothelial cell ICAM-1 expression in bladder cancer cell adherence.
24836091 2014 Are ICAM, VCAM and E-selectin levels different in first manic episode and subsequent remission?
24797984 2014 Increased expression of the intercellular adhesion molecule-1 (ICAM-1) on peripheral blood neutrophils in acute pancreatitis.
24795464 2014 ICAM-1: isoforms and phenotypes.
24792184 2014 Role of ICAM-1 polymorphisms (G241R, K469E) in mediating its single-molecule binding ability: atomic force microscopy measurements on living cells.
24789429 2014 Impacts of ICAM-1 gene polymorphisms on urothelial cell carcinoma susceptibility and clinicopathologic characteristics in Taiwan.
24785937 2015 Association between intercellular adhesion molecule-1 gene K469E polymorphism and the risk of stroke in a Chinese population: a meta-analysis.
24779300 2014 Cancer antigen-125 and ICAM-1 are together responsible for ascites in liver cirrhosis.
24742333 2014 E2F1 renders prostate cancer cell resistant to ICAM-1 mediated antitumor immunity by NF-?B modulation.
24702024 2014 Intercellular adhesion molecule-1 inhibits osteogenic differentiation of mesenchymal stem cells and impairs bio-scaffold-mediated bone regeneration in vivo.
24685520 2014 Transforming growth factor alpha promotes osteosarcoma metastasis by ICAM-1 and PI3K/Akt signaling pathway.
24667577 2014 Adiponectin enhances intercellular adhesion molecule-1 expression and promotes monocyte adhesion in human synovial fibroblasts.
24645721 2014 Intercellular adhesion molecule-1 polymorphisms in patients with Behçet disease: a meta-analysis.
24631282 2014 Intercellular adhesion molecule-1 expression in massive chronic intervillositis: implications for the invasion of maternal cells into fetal tissues.
24614587 2014 KSHV RTA abolishes NF?B responsive gene expression during lytic reactivation by targeting vFLIP for degradation via the proteasome.
24612665 2014 Association between the ICAM-1 K469E polymorphism and diabetic retinopathy in Type 2 diabetes mellitus: a meta-analysis.
24591755 2014 KE and EE genotypes of ICAM-1 gene K469E polymorphism is associated with severe preeclampsia.
24585879 2014 The RhoA guanine nucleotide exchange factor, LARG, mediates ICAM-1-dependent mechanotransduction in endothelial cells to stimulate transendothelial migration.
24576947 2014 HDL-transferred microRNA-223 regulates ICAM-1 expression in endothelial cells.
24558466 2014 Association of biomarkers of inflammation with dyslipidemia and its components among Mongolians in China.
24534074 2014 Diet quality and markers of endothelial function: the CARDIA study.
24516598 2014 Serum adhesion molecule levels as prognostic markers in patients with early systemic sclerosis: a multicentre, prospective, observational study.
24474251 2014 Investigation of intercellular adhesion molecules (ICAMs) gene expressions in patients with Barrett's esophagus.
24465662 2014 Maternal biomarkers of endothelial dysfunction and preterm delivery.
24457076 2014 Intercellular adhesion molecule 1/2 and E-selectin in plasma cell mastitis: immunohistochemical study of 35 cases.
24456036 2014 C-Reactive protein and soluble intracellular adhesion molecule-1 are related to pulse wave reflection in type 1 diabetes 1C-1.
24393359 2014 Integrative genomic analysis identifies a role for intercellular adhesion molecule 1 in childhood asthma.
24386348 2013 High plasma levels of soluble intercellular adhesion molecule (ICAM)-1 are associated with cerebral malaria.
24345805 2014 Transmigrated neutrophils in the intestinal lumen engage ICAM-1 to regulate the epithelial barrier and neutrophil recruitment.
24324686 2013 Tumor necrosis factor -?, interleukin-10, intercellular and vascular adhesion molecules are possible biomarkers of disease severity in complicated Plasmodium vivax isolates from Pakistan.
24312591 2013 Lipid Raft is required for PSGL-1 ligation induced HL-60 cell adhesion on ICAM-1.
24289603 2013 Investigation of ICAM-1 and ?3 integrin gene variations in patients with brain tumors.
24282904 2013 Expression of NFkappaB, ICAM1, and VCAM1 in rheumatic heart disease with atrial fibrillation.
24276753 2014 Involvement of the nuclear factor-?B pathway in the adhesion of neutrophils to renal tubular cells after injury induced by neonatal postasphyxial serum.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24273934 2013 IL-1 alpha regulates CXCL1, CXCL10 and ICAM1 in network form in oral keratinocytes.
24266503 2015 The association between bereavement and biomarkers of inflammation.
24222216 2013 Endothelial cells on the proliferation and expression of intercellular adhesion molecule 1 and interleukin 8 of vascular smooth muscle cells.
24162270 2014 Intercellular adhesion molecular-1, Fas, and Fas ligand as diagnostic biomarkers for acute allograft rejection of pancreaticoduodenal transplantation in pigs.
24157824 2013 CCL5/RANTES, sVCAM-1, and sICAM-1 in chronic spontaneous urticaria.
24088748 2013 The levels of the circulating cellular adhesion molecules ICAM-1, VCAM-1 and endothelin-1 and the flow-mediated vasodilatation values in patients with type 1 diabetes mellitus with early-stage diabetic retinopathy.
24083591 2013 Relation between K469E gene polymorphism of ICAM-1 and recurrence of ACS and cardiovascular mortality.
24077340 2013 Association of inflammatory gene polymorphisms and conventional risk factors with arterial stiffness by age.
24069166 2013 Combined effects of icam-1 single-nucleotide polymorphisms and environmental carcinogens on oral cancer susceptibility and clinicopathologic development.
23981064 2014 Mycobacterium tuberculosis infection of human dendritic cells decreases integrin expression, adhesion and migration to chemokines.
23953534 The impact of ICAM1 and VCAM1 gene polymorphisms on chronic allograft nephropathy and transplanted kidney function.
23935498 2013 An anti-human ICAM-1 antibody inhibits rhinovirus-induced exacerbations of lung inflammation.
23933413 2014 Prediction value of intercellular adhesion molecule-1 gene polymorphisms for epithelial ovarian cancer risk, clinical features, and prognosis.
23922864 2013 Intracellular adhesion molecule-1 K469E gene polymorphism and risk of diabetic microvascular complications: a meta-analysis.
23922493 2013 Status of serum VEGF and ICAM-1 and its association with external limiting membrane and inner segment-outer segment junction disruption in type 2 diabetes mellitus.
23906304 2013 Endotelial activation and flow-mediated vasodilation in young patients with breast cancer.
23904363 2013 Interleukin (IL)-4 induces production of cytokine-induced neutrophil chemoattractants (CINCs) and intercellular adhesion molecule (ICAM)-1 in lungs of asthmatic rats.
23884579 2013 Soluble ICAM-1 levels in small-cell lung cancer: prognostic value for survival and predictive significance for response during chemotherapy.
23845107 2013 Staphylococcus epidermidis and Staphylococcus aureus trigger different interleukin-8 and intercellular adhesion molecule-1 in lung cells: implications for inflammatory complications following neonatal sepsis.
23844251 2013 Soluble ICAM-5, a product of activity dependent proteolysis, increases mEPSC frequency and dendritic expression of GluA1.
23832872 2014 Upregulation of endogenous ICAM-1 reduces ovarian cancer cell growth in the absence of immune cells.
23803661 2013 Involvement of intercellular adhesion molecule-1 up-regulation in bradykinin promotes cell motility in human prostate cancers.
23792525 2013 The impact of ICAM1 and VCAM1 gene polymorphisms on long-term renal transplant function and recipient outcomes.
23777204 2013 Involvement of interferon-gamma genetic variants and intercellular adhesion molecule-1 in onset and progression of generalized vitiligo.
23770055 2013 Sphingosine-1-phosphate receptor-2 mediated NF?B activation contributes to tumor necrosis factor-? induced VCAM-1 and ICAM-1 expression in endothelial cells.
23728723 2013 Astragalus polysaccharides suppress ICAM-1 and VCAM-1 expression in TNF-?-treated human vascular endothelial cells by blocking NF-?B activation.
23726130 2013 Patterns of metastatic spread in early breast cancer.
23690481 2013 Enhancement of CCL15 expression and monocyte adhesion to endothelial cells (ECs) after hypoxia/reoxygenation and induction of ICAM-1 expression by CCL15 via the JAK2/STAT3 pathway in ECs.
23685129 Agonistic anti-ICAM-1 antibodies in scleroderma: activation of endothelial pro-inflammatory cascades.
23677452 2013 Receptors to interleukin-6 and adhesion molecules on circulating monocyte subsets in acute myocardial infarction.
23676335 2013 Hydrogen sulfide suppresses high glucose-induced expression of intercellular adhesion molecule-1 in endothelial cells.
23671702 2013 Curcumin nanoparticles ameliorate ICAM-1 expression in TNF-?-treated lung epithelial cells through p47 (phox) and MAPKs/AP-1 pathways.
23663325 2013 Modulation of airway epithelial cell functions by Pidotimod: NF-kB cytoplasmatic expression and its nuclear translocation are associated with an increased TLR-2 expression.
23625043 2013 Periodic vs constant high glucose in inducing pro-inflammatory cytokine expression in human coronary artery endothelial cells.
23620790 2013 CBAP functions as a novel component in chemokine-induced ZAP70-mediated T-cell adhesion and migration.
23616566 2013 Monocytes mediate metastatic breast tumor cell adhesion to endothelium under flow.
23609612 2013 Patterns of nucleotide and haplotype diversity at ICAM-1 across global human populations with varying levels of malaria exposure.
23581432 2013 Acute-phase concentrations of soluble fibrinogen inhibit neutrophil adhesion under flow conditions in vitro through interactions with ICAM-1 and MAC-1 (CD11b/CD18).
23576799 2013 Plasmin induces intercellular adhesion molecule 1 expression in human endothelial cells via nuclear factor-?B/mitogen-activated protein kinases-dependent pathways.
23561648 2013 Association of socioeconomic status, truncal fat and sICAM-1 with carotid intima-media thickness in adolescents: the HELENA study.
23558934 2013 Significance of autotaxin activity and overexpression in comparison to soluble intercellular adhesion molecule in thyroid cancer.
23554905 2013 RNA-seq reveals activation of both common and cytokine-specific pathways following neutrophil priming.
23551616 2013 Regulation of ICAM-1 expression in gingival fibroblasts infected with high-glucose-treated P.?gingivalis.
23502765 2013 Upregulation of adhesion molecules on leukemia targets improves the efficacy of cytotoxic T cells transduced with chimeric anti-CD19 receptor.
23493781 2013 Platelets activated during myocardial infarction release functional miRNA, which can be taken up by endothelial cells and regulate ICAM1 expression.
23457623 2013 TWEAK enhances E-selectin and ICAM-1 expression, and may contribute to the development of cutaneous vasculitis.
23438786 2013 D-ribose ameliorates cisplatin-induced nephrotoxicity by inhibiting renal inflammation in mice.
23417849 2013 Plasma concentration of soluble intercellular adhesion molecule-1 (sICAM-1) is elevated in type 2 diabetic patients, and sICAM-1 synthesis is associated with leptin-induced activation of the mitogen-activated protein kinase (MAPK) pathway.
23383040 2013 Dengue virus enhances thrombomodulin and ICAM-1 expression through the macrophage migration inhibitory factor induction of the MAPK and PI3K signaling pathways.
23376424 2013 Expression of intercellular adhesion molecule 1 by hepatocellular carcinoma stem cells and circulating tumor cells.
23376231 2013 Loss of p53 in stromal fibroblasts promotes epithelial cell invasion through redox-mediated ICAM1 signal.
23364881 2013 Intercellular adhesion molecule-1 (ICAM-1) expression correlates with oral cancer progression and induces macrophage/cancer cell adhesion.
23356193 Maternal plasma levels of endothelial dysfunction mediators including AM, CGRP, sICAM-1 and tHcy in pre-eclampsia.
23349778 2013 Evidence for the role of Epstein Barr Virus infections in the pathogenesis of acute coronary events.
23297413 2013 Molecular architecture of a complex between an adhesion protein from the malaria parasite and intracellular adhesion molecule 1.
23264465 2013 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23238746 2013 SIRT1 suppresses PMA and ionomycin-induced ICAM-1 expression in endothelial cells.
23232649 2013 Sphingosine kinase 1 promotes tumor progression and confers malignancy phenotypes of colon cancer by regulating the focal adhesion kinase pathway and adhesion molecules.
23227846 2012 Increased levels of soluble ICAM-1 in chronic obstructive pulmonary disease and resistant smokers are related to active smoking.
23209327 2013 A novel domain cassette identifies Plasmodium falciparum PfEMP1 proteins binding ICAM-1 and is a target of cross-reactive, adhesion-inhibitory antibodies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178493 2013 Essential role of cooperative NF-?B and Stat3 recruitment to ICAM-1 intronic consensus elements in the regulation of radiation-induced invasion and migration in glioma.
23162921 2012 [Expression of serum sICAM-1 in patients with primary hepatocellular carcinoma and its relationship with liver fibrosis].
23144497 2012 Leukocyte function antigen-1, kindlin-3, and calcium flux orchestrate neutrophil recruitment during inflammation.
23137758 2013 Genetic polymorphisms of ICAM 1 and IL28 as predictors of liver fibrosis severity and viral clearance in hepatitis C genotype 4.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23111892 2013 Sarpogrelate inhibits the expression of ICAM-1 and monocyte-endothelial adhesion induced by high glucose in human endothelial cells.
23098564 2012 CXC chemokine ligand 12/stromal cell-derived factor-1 regulates cell adhesion in human colon cancer cells by induction of intercellular adhesion molecule-1.
23095194 2013 Clinical evaluation of soluble intercellular adhesion molecule-1 and insulin like growth factor-binding protein-1-based rapid immunoassays for the diagnosis of prelabor rupture of membranes.
23089253 2013 Essential role of RIG-I in the activation of endothelial cells by dengue virus.
23057424 2013 Glycemic control and high-density lipoprotein characteristics in adolescents with type 1 diabetes.
23053969 2012 G241R and K469E polymorphisms of intercellular adhesion molecule 1 (ICAM-1) could predispose to Hashimoto thyroiditis.
23053371 2013 Expressions of nuclear factor-kappa B p50 and p65 and their significance in the up-regulation of intercellular cell adhesion molecule-1 mRNA in the nasal mucosa of allergic rhinitis patients.
23042271 2012 Protein C activation peptide inhibits the expression of ICAM-1, VCAM-1, and interleukin-8 induced by TNF-? in human dermal microvascular endothelial cells.
23039186 2012 LFA-1 and ICAM-1 expression induced during melanoma-endothelial cell co-culture favors the transendothelial migration of melanoma cell lines in vitro.
22990627 2013 Increase in IL-6, TNF-?, and MMP-9, but not sICAM-1, concentrations depends on exercise duration.
22976263 2012 High-flux and low-flux dialysis membranes and levels of intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 in children with chronic kidney failure.
22972240 2013 The effects of aerobic training and age on plasma sICAM-1.
22909232 2012 Cytoadherence in paediatric malaria: ABO blood group, CD36, and ICAM1 expression and severe Plasmodium falciparum infection.
22905988 2012 Higher serum levels of soluble intracellular cell adhesion molecule-1 and soluble vascular cell adhesion molecule predict peripheral artery disease in haemodialysis patients.
22815910 2012 Vitamin E isoforms differentially regulate intercellular adhesion molecule-1 activation of PKC? in human microvascular endothelial cells.
22804504 2012 Wiskott-Aldrich syndrome protein controls antigen-presenting cell-driven CD4+ T-cell motility by regulating adhesion to intercellular adhesion molecule-1.
22782142 2012 IGF-1 alleviates ox-LDL-induced inflammation via reducing HMGB1 release in HAECs.
22780972 2012 [ICAM-1 469K/E gene polymorphisms increase the risk of gastric dysplasia].
22763828 2012 Expression of PCNA, ICAM-1, and vimentin in lens epithelial cells of cataract patients with and without type 2 diabetes.
22763042 2012 Unfractionated heparin inhibits lipopolysaccharide-induced inflammatory response through blocking p38 MAPK and NF-?B activation on endothelial cell.
22742445 2012 The NF-?B target genes ICAM-1 and VCAM-1 are differentially regulated during spontaneous differentiation of Caco-2 cells.
22717098 2013 Importance of adhesion molecules for children with congenital heart disease.
22707713 2012 Leukocyte function-associated antigen-1/intercellular adhesion molecule-1 interaction induces a novel genetic signature resulting in T-cells refractory to transforming growth factor-? signaling.
22706247 2012 Changes of serum adiponectin and soluble intercellular adhesion molecule-1 concentrations after smoking cessation.
22705151 2012 ssICAM-1, IL-21 and IL-23 in patients with tick borne encephalitis and neuroborreliosis.
22697794 2013 Antibody against integrin lymphocyte function-associated antigen 1 inhibits HIV type 1 infection in primary cells through caspase-8-mediated apoptosis.
22685016 2012 Urinary sediment ICAM-1 level in lupus nephritis.
22648254 2012 Genetic variations in E-selectin and ICAM-1: relation to atherosclerosis.
22646485 2013 Association between genetic variants in adhesion molecules and outcomes after hematopoietic cell transplants.
22644863 2012 Interleukin-11 increases cell motility and up-regulates intercellular adhesion molecule-1 expression in human chondrosarcoma cells.
22619799 2012 [Distribution of human enterovirus 71 in brainstem of infants with brain stem encephalitis and infection mechanism].
22609871 2013 Effects of atorvastatin on expression of ICAM-1 in atherosclerotic rabbits.
22609477 2012 The intercellular adhesion molecule-1 (ICAM-1) gene polymorphism K469E in end-stage renal disease patients with cardiovascular disease.
22593994 2011 [Associations of ICAM1 gene and VCAM1 promoter polymorphisms with transplanted kidney function].
22588952 2012 The study of soluble intercellular adhesion molecule-1 and ghrelin in adolescents with family history of type 2 diabetes.
22562265 2012 The single nucleotide polymorphism g.1548A >G (K469E) of the ICAM-1 gene is associated with worse prognosis in non-small cell lung cancer.
22560286 2012 OxLDL and substrate stiffness promote neutrophil transmigration by enhanced endothelial cell contractility and ICAM-1.
22552879 2012 ?(M)?(2)-integrin-intercellular adhesion molecule-1 interactions drive the flow-dependent trafficking of Guillain-Barré syndrome patient derived mononuclear leukocytes at the blood-nerve barrier in vitro.
22552687 2012 The effect of diet and exercise on markers of endothelial function in overweight and obese women with polycystic ovary syndrome.
22541082 2012 [Expression of ICAM-1 (CD54) in pediatric tumor and acute leukemia and its clinic significance in immunotherapy with CIK cell].
22533155 2011 [Role of the polymorphisms within genes encoding proteins related to endothelial dysfunction in coronary artery disease].
22525368 2012 Toxoplasma gondii tachyzoites cross retinal endothelium assisted by intercellular adhesion molecule-1 in vitro.
22523875 Intercellular adhesion molecule-1 K469E polymorphism: Is it associated with preeclampsia in the Korean population?
22523428 2012 Variation in the ICAM1-ICAM4-ICAM5 locus is associated with systemic lupus erythematosus susceptibility in multiple ancestries.
22497223 2012 Association between the levels of circulating adhesion molecules and biopterins in type-2 diabetic normotensive patients adhesion molecules and biopterins.
22496445 2012 Identification of intercellular cell adhesion molecule 1 (ICAM-1) as a hypoglycosylation marker in congenital disorders of glycosylation cells.
22489699 2012 Vascular endothelial growth factor and soluble intercellular adhesion molecule-1 in lung adenocarcinoma with malignant pleural effusion: correlations with patient survival and pleural effusion control.
22463128 2012 Pivotal roles of shear stress in the microenvironmental changes that occur within sentinel lymph nodes.
22404936 2012 Epinephrine modulates BCAM/Lu and ICAM-4 expression on the sickle cell trait red blood cell membrane.
22396143 2012 Significance of platelet endothelial cell adhesion molecule-1 (PECAM-1) and intercellular adhesion molecule-1 (ICAM-1) expressions in preeclamptic placentae.
22378736 2012 Modulation of the association between plasma intercellular adhesion molecule-1 and cancer risk by n-3 PUFA intake: a nested case-control study.
22378734 2012 Effects of n-3 PUFA supplementation on plasma soluble adhesion molecules: a meta-analysis of randomized controlled trials.
22349390 2012 [Association of intercellular adhesion molecule-1 gene K469E polymorphism with chronic obstructive pulmonary disease].
22345292 2012 CCN3 increases cell motility and ICAM-1 expression in prostate cancer cells.
22324942 2012 Urine sVCAM-1 and sICAM-1 levels are elevated in lupus nephritis.
22294843 2012 Polymorphisms of ICAM-1 are associated with gastric cancer risk and prognosis.
22248682 2012 Lung cancer cell invasion and expression of intercellular adhesion molecule-1 (ICAM-1) are attenuated by secretory phospholipase A? inhibition.
22234743 2012 Differences in sensitivity to tumor-specific CTLs between primary and metastatic esophageal cancer cell lines derived from the same patient.
22226679 2012 Human lactoferrin suppresses TNF-?-induced intercellular adhesion molecule-1 expression via competition with NF-?B in endothelial cells.
22226621 2012 GEF-H1/RhoA signalling pathway mediates lipopolysaccharide-induced intercellular adhesion molecular-1 expression in endothelial cells via activation of p38 and NF-?B.
22209338 2012 Prognostic significance of adhesion molecules (sICAM-1, sVCAM-1) and VEGF in colorectal cancer patients.
22203486 2012 Intercellular adhesion molecule 1 gene K469E polymorphism is associated with coronary heart disease risk: a meta-analysis involving 12 studies.
22198381 2012 Cannabidiol inhibits lung cancer cell invasion and metastasis via intercellular adhesion molecule-1.
22183741 2012 Curcumin attenuates TNF-?-induced expression of intercellular adhesion molecule-1, vascular cell adhesion molecule-1 and proinflammatory cytokines in human endometriotic stromal cells.
22119941 2012 Combined effect of cytokine gene polymorphisms on end-stage knee osteoarthritis from Chinese Han population.
22103402 2012 Functional analysis of Plasmodium vivax VIR proteins reveals different subcellular localizations and cytoadherence to the ICAM-1 endothelial receptor.
22059356 2009 Soluble intercellular adhesion molecule-1 (slCAM-1) for early diagnosis of neonatal infections.
22045868 2012 Natural killer cell-produced IFN-? and TNF-? induce target cell cytolysis through up-regulation of ICAM-1.
22023772 The adhesion molecule ICAM-1 is overexpressed in patients with Hymenoptera venom allergy and decreases after ultrarush venom immunotherapy.
22015609 2012 Soluble intracellular adhesion molecule-1 secreted by human umbilical cord blood-derived mesenchymal stem cell reduces amyloid-? plaques.
22010135 2011 Association of variation at the ABO locus with circulating levels of soluble intercellular adhesion molecule-1, soluble P-selectin, and soluble E-selectin: a meta-analysis.
22001052 Adhesion molecule expression and ventricular remodeling in chronic rheumatic heart disease: a cause or effect in the disease progression--a pilot study.
21987404 2012 Intercellular adhesion molecule-1 E469K gene polymorphism and coronary artery disease in the Chinese population: a meta-analysis involving 3065 subjects.
21980389 2011 Tumor site immune markers associated with risk for subsequent basal cell carcinomas.
21972703 2010 [Prognostic value of the molecular markers ICAM-1 and C-JUN in patients with lung cancer].
21895545 2012 Prognostic value of serum CD44, intercellular adhesion molecule-1 and vascular cell adhesion molecule-1 levels in patients with indolent non-Hodgkin lymphomas.
21890178 2012 Macrophage migration inhibitory factor induces ICAM-1and thrombomobulin expression in vitro.
21877251 2011 RNA released from necrotic keratinocytes upregulates intercellular adhesion molecule-1 expression in melanocytes.
21871109 2011 Circulating CD133+CD34+ progenitor cells inversely correlate with soluble ICAM-1 in early ischemic stroke patients.
21860531 2011 Involvement of MAPKs in ICAM-1 expression in glomerular endothelial cells in diabetic nephropathy.
21843619 2011 Ethyl gallate isolated from Pistacia integerrima Linn. inhibits cell adhesion molecules by blocking AP-1 transcription factor.
21840991 2011 Determining beta2-integrin and intercellular adhesion molecule 1 binding kinetics in tumor cell adhesion to leukocytes and endothelial cells by a gas-driven micropipette assay.
21828047 2011 Reduced expression of adipose triglyceride lipase enhances tumor necrosis factor alpha-induced intercellular adhesion molecule-1 expression in human aortic endothelial cells via protein kinase C-dependent activation of nuclear factor-kappaB.
21816944 2011 Interleukin-1 alpha produced by human T-cell leukaemia virus type I-infected T cells induces intercellular adhesion molecule-1 expression on lung epithelial cells.
21808112 Role of cell adhesion molecules in acute ischemic stroke.
21804483 2011 Soluble intercellular cell adhesion molecule-1 and vascular cell adhesion molecule-1 in asymptomatic dyslipidemic subjects.
21798038 2011 Non-cysteine linked MUC1 cytoplasmic dimers are required for Src recruitment and ICAM-1 binding induced cell invasion.
21725974 2011 Genome-wide transcriptional profiling analysis of all trans retinoic acid-treated tongue carcinoma SCC-9 cells.
21724992 2011 Bacteroides fragilis enterotoxin upregulates intercellular adhesion molecule-1 in endothelial cells via an aldose reductase-, MAPK-, and NF-?B-dependent pathway, leading to monocyte adhesion to endothelial cells.
21717173 2011 Lack of association between intercellular adhesion molecule-1 (ICAM-1) polymorphisms and polycystic ovary syndrome.
21680714 2011 c-Met recruits ICAM-1 as a coreceptor to compensate for the loss of CD44 in Cd44 null mice.
21658317 Procalcitonin, C-reactive protein, interleukin-6, and soluble intercellular adhesion molecule-1 as markers of postoperative orthopaedic joint prosthesis infections.
21635548 2011 Microvesicular fat, inter cellular adhesion molecule-1 and regulatory T-lymphocytes are of importance for the inflammatory process in livers with non-alcoholic steatohepatitis.
21628959 2011 The relationship between CD86 and CD54 protein expression and cytotoxicity following stimulation with contact allergen in THP-1 cells.
21610569 2011 Trauma-activated polymorphonucleated leukocytes damage endothelial progenitor cells: probable role of CD11b/CD18-CD54 interaction and release of reactive oxygen species.
21594636 2011 Interleukin-6, but not soluble adhesion molecules, predicts a subsequent mortality from cardiovascular disease in patients with acute ST-segment elevation myocardial infarction.
21590495 2011 Prognostic value of intercellular adhesion molecule (ICAM)-1 expression in breast cancer.
21571262 2011 Effect of age on surface molecules and cytokine expression in human dendritic cells.
21551251 2011 Endogenous PMN sialidase activity exposes activation epitope on CD11b/CD18 which enhances its binding interaction with ICAM-1.
21542832 2011 Paeoniflorin suppresses the expression of intercellular adhesion molecule-1 (ICAM-1) in endotoxin-treated human monocytic cells.
21540444 2011 Hyperketonemia increases monocyte adhesion to endothelial cells and is mediated by LFA-1 expression in monocytes and ICAM-1 expression in endothelial cells.
21536861 2011 Kindlin-3 is required for the stabilization of TCR-stimulated LFA-1:ICAM-1 bonds critical for lymphocyte arrest and spreading on dendritic cells.
21536333 2011 Vascular and extravascular immunoreactivity for intercellular adhesion molecule 1 in the orbitofrontal cortex of subjects with major depression: age-dependent changes.
21533024 2011 Genome-wide association analysis of soluble ICAM-1 concentration reveals novel associations at the NFKBIK, PNPLA3, RELA, and SH2B3 loci.
21520070 2011 Resistin induces monocyte-endothelial cell adhesion by increasing ICAM-1 and VCAM-1 expression in endothelial cells via p38MAPK-dependent pathway.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21474934 2011 Genetic associations of autopsy-confirmed vascular dementia subtypes.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21392767 2011 Polymorphisms in the ICAM1 gene predict circulating soluble intercellular adhesion molecule-1(sICAM-1).
21391218 2012 CCN6 enhances ICAM-1 expression and cell motility in human chondrosarcoma cells.
21390226 2011 Specific receptor usage in Plasmodium falciparum cytoadherence is associated with disease outcome.
21344487 2011 Monocytes induce proximal tubular epithelial-mesenchymal transition through NF-kappa B dependent upregulation of ICAM-1.
21328467 2011 RANKL increases migration of human lung cancer cells through intercellular adhesion molecule-1 up-regulation.
21287514 2011 [No association of K469E polymorphism of intercellular adhesion molecule-1 with rheumatoid arthritis].
21286024 2011 Morphine postconditioning attenuates ICAM-1 expression on endothelial cells.
21276792 2011 Morphologic and proteomic characterization of exosomes released by cultured extravillous trophoblast cells.
21270398 2011 ?2 integrin induces TCR?-Syk-phospholipase C-? phosphorylation and paxillin-dependent granule polarization in human NK cells.
21269460 2011 Initial characterization of the human central proteome.