Property Summary

Ligand Count 102
NCBI Gene PubMed Count 1,046
PubMed Score 9269.30
PubTator Score 5040.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Tear film insufficiency 15
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Atherosclerosis 291 6.438 3.2

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis -1.600 4.6e-04
ulcerative colitis 2.000 1.3e-05
adult high grade glioma 1.600 1.0e-03
aldosterone-producing adenoma -1.383 2.8e-02
Astrocytoma, Pilocytic 1.800 5.1e-07
atypical teratoid / rhabdoid tumor 1.300 3.0e-03
Bipolar Disorder 1.678 2.0e-02
cutaneous lupus erythematosus 1.100 6.8e-03
cystic fibrosis 1.122 5.2e-04
ependymoma 1.300 4.9e-04
gastric carcinoma 1.800 1.6e-02
glioblastoma 1.100 3.6e-03
head and neck cancer 1.400 1.5e-04
head and neck cancer and chronic obstruc... 1.200 3.2e-03
interstitial cystitis 1.400 4.9e-04
invasive ductal carcinoma -1.663 2.1e-02
lung cancer -4.400 1.2e-06
lung carcinoma -3.800 7.1e-24
malignant mesothelioma -1.600 2.6e-07
nasopharyngeal carcinoma 1.100 1.2e-02
non-small cell lung cancer -1.749 3.8e-09
pancreatic cancer 1.900 4.4e-03
primary pancreatic ductal adenocarcinoma 2.059 3.1e-03
tuberculosis -1.500 1.3e-02
urothelial carcinoma -1.500 3.7e-03

PDB (12)

Gene RIF (1100)

AA Sequence

MAPSSPRPALPALLVLLGALFPGPGNAQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELL      1 - 70
LPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGG     71 - 140
APRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQ    141 - 210
TFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTA    211 - 280
EDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPL    281 - 350
GPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ    351 - 420
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEIVIITVVAAA    421 - 490
VIMGTAGLSTYLYNRQRKIKKYRLQQAQKGTPMKPNTQATPP                                491 - 532
//

Text Mined References (1061)

PMID Year Title