Property Summary

NCBI Gene PubMed Count 15
PubMed Score 16.09
PubTator Score 4.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8491 4.6e-04
breast carcinoma 1614 5.3e-03
Rheumatoid Arthritis 1170 2.0e-02
progressive supranuclear palsy 674 3.4e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Corneal disease 32 0.0 2.0
Disease Target Count Z-score Confidence
chronic lymphocytic leukemia 244 3.898 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
Rheumatoid Arthritis 1.100 2.0e-02
breast carcinoma 1.300 5.3e-03
progressive supranuclear palsy -1.100 3.4e-02
ovarian cancer -1.400 4.6e-04

Gene RIF (7)

PMID Text
25882842 CRL3(IBTK) is a novel ubiquitin ligase with regulatory roles in cellular pathways, such as the Pdcd4-dependent translation of mRNAs
24648495 Depletion of IBTKalpha by short hairpin RNA reduced viability of cultured cells coincident with increased caspase 3/7 cleavage, suggesting that IBTKalpha is a key regulator in determining cell fate during the UPR.
21482705 A novel pathway of Btk regulation via protein kinase C phosphorylation of IBtkgamma.
20721470 three novel (Ala347fsX55, I355T, and Thr324fsX24) mutations in Bruton's tyrosine kinase in patients with X-linked agammaglobulinemia
19782003 The IBTK gene encodes the proteins IBtk-alpha, beta and gamma that regulate the B cell receptor signalling through Bruton's tyrosine kinase, which promotes B cell survival and differentiation.
19460752 Knockdown of inhibitor of Bruton agammaglobulinemia tyrosine kinase (IBTK) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18596081 Identification of three IBTKalpha, IBTKbeta and IBTKgamma mRNAs, whose transcription is driven by two distinct promoter regions.

AA Sequence

MSSPMPDCTSKCRSLKHALDVLSVVTKGSENQIKAFLSSHCYNAATIKDVFGRNALHLVSSCGKKGVLDW      1 - 70
LIQKGVDLLVKDKESGWTALHRSIFYGHIDCVWSLLKHGVSLYIQDKEGLSALDLVMKDRPTHVVFKNTD     71 - 140
PTDVYTWGDNTNFTLGHGSQNSKHHPELVDLFSRSGIYIKQVVLCKFHSVFLSQKGQVYTCGHGPGGRLG    141 - 210
HGDEQTCLVPRLVEGLNGHNCSQVAAAKDHTVVLTEDGCVYTFGLNIFHQLGIIPPPSSCNVPRQIQAKY    211 - 280
LKGRTIIGVAAGRFHTVLWTREAVYTMGLNGGQLGCLLDPNGEKCVTAPRQVSALHHKDIALSLVAASDG    281 - 350
ATVCVTTRGDIYLLADYQCKKMASKQLNLKKVLVSGGHMEYKVDPEHLKENGGQKICILAMDGAGRVFCW    351 - 420
RSVNSSLKQCRWAYPRQVFISDIALNRNEILFVTQDGEGFRGRWFEEKRKSSEKKEILSNLHNSSSDVSY    421 - 490
VSDINSVYERIRLEKLTFAHRAVSVSTDPSGCNFAILQSDPKTSLYEIPAVSSSSFFEEFGKLLREADEM    491 - 560
DSIHDVTFQVGNRLFPAHKYILAVHSDFFQKLFLSDGNTSEFTDIYQKDEDSAGCHLFVVEKVHPDMFEY    561 - 630
LLQFIYTDTCDFLTHGFKPRIHLNKNPEEYQGTLNSHLNKVNFHEDDNQKSAFEVYKSNQAQTVSERQKS    631 - 700
KPKSCKKGKNIREDDPVRMLQTVAKKFDFSNLSSRLDGVRFENEKINVIAKNTGNKLKLSQKKCSFLCDV    701 - 770
TMKSVDGKEFPCHKCVLCARLEYFHSMLSSSWIEASSCAALEMPIHSDILKVILDYLYTDEAVVIKESQN    771 - 840
VDFICSVLVVADQLLITRLKEICEVALTEKLTLKNAAMLLEFAAMYSAKQLKLSCLQFIGLNMAALLEAR    841 - 910
SLDVLSDGVLKDLSEFYRKMIPAMDRRVITPYQDGPDISYLEVEDGDIFLKEEINMEQNHSETMFKKAKT    911 - 980
KAKKKPRKRSDSSGGYNLSDIIQSPSSTGLLKSGKTNSVESLPELLTSDSEGSYAGVGSPRDLQSPDFTT    981 - 1050
GFHSDKIEAKVKPYVNGTSPVYSREDLKPWEKSPILKISAPQPIPSNRIDTTSSASWVAGSFSPVSPPVV   1051 - 1120
DLRTIMEIEESRQKCGATPKSHLGKTVSHGVKLSQKQRKMIALTTKENNSGMNSMETVLFTPSKAPKPVN   1121 - 1190
AWASSLHSVSSKSFRDFLLEEKKSVTSHSSGDHVKKVSFKGIENSQAPKIVRCSTHGTPGPEGNHISDLP   1191 - 1260
LLDSPNPWLSSSVTAPSMVAPVTFASIVEEELQQEAALIRSREKPLALIQIEEHAIQDLLVFYEAFGNPE   1261 - 1330
EFVIVERTPQGPLAVPMWNKHGC                                                  1331 - 1353
//

Text Mined References (23)

PMID Year Title
25882842 2015 CRL3IBTK Regulates the Tumor Suppressor Pdcd4 through Ubiquitylation Coupled to Proteasomal Degradation.
24648495 2014 Selective mRNA translation during eIF2 phosphorylation induces expression of IBTK?.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23291589 2013 Genome-wide association analyses identify multiple loci associated with central corneal thickness and keratoconus.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21482705 2011 Btk regulation in human and mouse B cells via protein kinase C phosphorylation of IBtk?.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20721470 2010 Mutations of Bruton's tyrosine kinase gene in Brazilian patients with X-linked agammaglobulinemia.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19782003 2009 Computational analysis and in vivo validation of a microRNA encoded by the IBTK gene, a regulator of B-lymphocytes differentiation and survival.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18596081 2008 Physical and functional characterization of the genetic locus of IBtk, an inhibitor of Bruton's tyrosine kinase: evidence for three protein isoforms of IBtk.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11577348 2001 Direct inhibition of Bruton's tyrosine kinase by IBtk, a Btk-binding protein.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.