Property Summary

NCBI Gene PubMed Count 47
PubMed Score 722.99
PubTator Score 293.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
glioblastoma 2.800 1.8e-02
posterior fossa group A ependymoma 3.300 6.4e-06
atypical teratoid / rhabdoid tumor 2.000 7.2e-03
pediatric high grade glioma 2.800 2.0e-03
pilocytic astrocytoma 1.500 2.9e-02
Breast cancer 1.400 2.7e-04
ductal carcinoma in situ 1.400 4.1e-02
invasive ductal carcinoma 1.300 3.7e-02
ovarian cancer 1.100 1.9e-02
psoriasis -1.600 2.0e-07

Gene RIF (37)

PMID Text
26568273 Two significant SNPs within IBSP, rs1054627 and rs17013181, were associated with BMD and postmenopausal osteoporosis by the two-stage strategy, and rs17013181 was also significantly associated with serum IBSP levels.
26413977 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25973097 the strong correlation between bone sialoprotein and OPN and papillary thyroid carcinoma suggests a role for BSP and OPN in calcification and tumor progression of papillary thyroid carcinoma
25504218 oxidized low-density lipoprotein-induced expression dependent on Runx2 expression
24530278 Bone sialoprotein could be a key mediator of the hypertrophic chondrocytes-induced angiogenesis of osteoarthritis.
24071501 Current evidence demonstrates that BSP and OPN, play significant roles in bone metastasis of osteotropic malignancies derived from breast, prostate, lung, thyroid, and multiple myeloma. [review]
23726130 High expression of bone sialoprotein in breast neoplasms was associated with cytokeratin-positive cells in bone marrow, but not with lymph node metastasis.
23667544 BSP silencing decreased the integrin alphavbeta3 and beta3 levels, in turn inhibiting cell migration and invasion and decreasing the ability of the cells to metastasize to bone.
23485603 results indicate that FGF2 increases BSP transcription by targeting the FRE and AP1 elements in the proximal promoter of the human BSP gene.
23314561 IBSP mRNA is over expressed in carotid atheroma plaque (3.74 fold, p = 1.41E-09) in an intraindividual comparison.
23119009 High BSP expression occurs in a significant subset of high-grade glioma patients and predicts a poorer outcome
22865667 HTRA1 has a central role in osteogenesis through modification of proteins within the extracellular matrix, in particular, ibsp.
22349547 human primary cementoblasts subjected to compression and IL-1beta stimulation impeded BSP and CEMP-1 expression, proteins that are associated with cementogenesis.
22266579 Our results suggest that SSEA-4 is a specific cell surface antigen that can be used to identify dental pulp stem cells.
20967421 OPN plasma levels are associated with the genetic polymorphisms in integrin-binding sialoprotein gene locus (IBSP)
20967421 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20654748 Observational study of gene-disease association. (HuGE Navigator)
20164292 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19492334 cooperative mechanisms by which BSP can enhance specific factors associated with a metastatic phenotype in tumor cell lines, an effect that is increased by circulating TGF-beta1 and EGF.
19460752 Knockdown of integrin-binding sialoprotein (IBSP) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19453261 Observational study of gene-disease association. (HuGE Navigator)
19386107 Studies do not support a role for BSP in promoting metastasis through interactions with pro-MMP-2.
19376608 BSP protein expression in the primary resected non-small-cell lung cancer is strongly associated with bone metastasis and could be used to identify high-risk patients.
19127545 PTH stimulates human BSP gene transcription by targeting the two cAMP response elements in the promoter of the human BSP gene.
19079262 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18302613 has an angiogenic capacity; important in the differentiation of osteoblasts, bone matrix mineralization and tumor metastasis [review]
17956871 Runx2 and HDAC3 repress BSP gene expression and that this repression is suspended upon osteoblastic cell differentiation.
17213971 May be a prognostic marker for bone metastasis in breast cancer.
17050866 bone sialoprotein expression in the primary resected NSCLC is strongly associated with BM progression and could be useful in identifying high-risk patients who could benefit from novel modalities of surveillance and preventive treatment
16995818 Bone sialoprotein is involved in migration of bone marrow stromal cells through Matrigel and collagen barriers.
16000302 Data show that RUNX2 is a direct regulator of bone sialoprotein in osteoblasts and that it functions in cooperation with DLX5 or a related factor to activate osteoblast-specific gene expression.
15795688 The time course of the expression of BSP wss visualized after dental implnt implatation in mandibular bone fibroblasts.
14524533 BSP is expressed in breast and prostate cancer and has a role as a stimulator of bone mineralisation
12750290 Osteoblast-related transcription factors Runx2 (Cbfa1/AML3) and MSX2 mediate the expression of bone sialoprotein in human metastatic breast cancer cells.
11979972 has RGD sequence, affinity to collagen, and induces mineral crystal formation
11968014 RT-PCR analysis of human bone marrow stromal cells during osteogenesis in vitro: the mRNA levels of bone morphogenetic protein-2 (BMP-2), bone sialoprotein-II (BSP), osteopontin (OP) and cbfa-1 increased with culture time in osteogenic medium.
11459848 Eight threonines modified by O-glycans were identified, leaving the C terminus of the protein free of glycans. The recombinant protein showed similar secondary structures as bone-derived BSP

AA Sequence

MKTALILLSILGMACAFSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEEN      1 - 70
GDDSSEEEEEEEETSNEGENNEESNEDEDSEAENTTLSATTLGYGEDATPGTGYTGLAAIQLPKKAGDIT     71 - 140
NKATKEKESDEEEEEEEEGNENEESEAEVDENEQGINGTSTNSTEAENGNGSSGGDNGEEGEEESVTGAN    141 - 210
AEDTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTVEYEGEYEYTGANEYDNGYEIYES    211 - 280
ENGEPRGDNYRAYEDEYSYFKGQGYDGYDGQNYYHHQ                                     281 - 317
//

Text Mined References (49)

PMID Year Title
26568273 2015 Endochondral ossification pathway genes and postmenopausal osteoporosis: Association and specific allele related serum bone sialoprotein levels in Han Chinese.
26413977 2016 Preameloblast-Derived Factors Mediate Osteoblast Differentiation of Human Bone Marrow Mesenchymal Stem Cells by Runx2-Osterix-BSP Signaling.
25973097 2015 Correlation between calcification and bone sialoprotein and osteopontin in papillary thyroid carcinoma.
25504218 2015 Oxidized low-density lipoprotein increases bone sialoprotein expression in vascular smooth muscle cells via runt-related transcription factor 2.
24530278 2014 Bone sialoprotein as a potential key factor implicated in the pathophysiology of osteoarthritis.
24071501 2014 Bone sialoprotein and osteopontin in bone metastasis of osteotropic cancers.
23726130 2013 Patterns of metastatic spread in early breast cancer.
23667544 2013 BSP gene silencing inhibits migration, invasion, and bone metastasis of MDA-MB-231BO human breast cancer cells.
23485603 2013 Transcriptional regulation of the human bone sialoprotein gene by fibroblast growth factor 2.
23314561 2012 Microarray analysis reveals overexpression of IBSP in human carotid plaques.
23119009 2012 High bone sialoprotein (BSP) expression correlates with increased tumor grade and predicts a poorer prognosis of high-grade glioma patients.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22865667 2012 Human serine protease HTRA1 positively regulates osteogenesis of human bone marrow-derived mesenchymal stem cells and mineralization of differentiating bone-forming cells through the modulation of extracellular matrix protein.
22349547 2012 Human primary cementoblasts respond to combined IL-1? stimulation and compression with an impaired BSP and CEMP-1 expression.
22266579 2012 Stage-specific embryonic antigen-4 identifies human dental pulp stem cells.
21533022 2011 Genome-wide association study using extreme truncate selection identifies novel genes affecting bone mineral density and fracture risk.
20967421 2011 Quantitative genetic study of the circulating osteopontin in community-selected families.
20654748 2010 High-density polymorphisms analysis of 23 candidate genes for association with bone mineral density.
20164292 2010 Genome-wide association study of bone mineral density in premenopausal European-American women and replication in African-American women.
19492334 2009 Bone sialoprotein stimulates focal adhesion-related signaling pathways: role in migration and survival of breast and prostate cancer cells.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19386107 2009 Bone sialoprotein does not interact with pro-gelatinase A (MMP-2) or mediate MMP-2 activation.
19376608 2010 Predictive significance of bone sialoprotein and osteopontin for bone metastases in resected Chinese non-small-cell lung cancer patients: a large cohort retrospective study.
19127545 2009 Parathyroid hormone regulation of the human bone sialoprotein gene transcription is mediated through two cAMP response elements.
19079262 2009 New sequence variants associated with bone mineral density.
18302613 2008 Bone sialoprotein and its transcriptional regulatory mechanism.
17956871 2007 Runx2- and histone deacetylase 3-mediated repression is relieved in differentiating human osteoblast cells to allow high bone sialoprotein expression.
17213971 2006 [PTHrP and bone sialoprotein as prognostic markers for developing bone metastases in breast cancer patients].
17050866 2006 Bone sialoprotein is predictive of bone metastases in resectable non-small-cell lung cancer: a retrospective case-control study.
16995818 2006 Bone sialoprotein enhances migration of bone marrow stromal cells through matrices by bridging MMP-2 to alpha(v)beta3-integrin.
16210410 2005 Differential expression profiling of membrane proteins by quantitative proteomics in a human mesenchymal stem cell line undergoing osteoblast differentiation.
16000302 2005 Cooperative interactions between RUNX2 and homeodomain protein-binding sites are critical for the osteoblast-specific expression of the bone sialoprotein gene.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15795688 2005 Effects of dental implant surfaces on the expression of bone sialoprotein in cells derived from human mandibular bone.
14524533 2003 Differential expression of osteopontin and bone sialoprotein in bone metastasis of breast and prostate carcinoma.
12750290 2003 Osteoblast-related transcription factors Runx2 (Cbfa1/AML3) and MSX2 mediate the expression of bone sialoprotein in human metastatic breast cancer cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979972 2002 [Recent advances in research on bone matrix proteins].
11968014 2002 Real-time quantitative RT-PCR analysis of human bone marrow stromal cells during osteogenic differentiation in vitro.
11669636 2001 Posttranslational modifications to human bone sialoprotein determined by mass spectrometry.
11459848 2001 Structural characterization of human recombinant and bone-derived bone sialoprotein. Functional implications for cell attachment and hydroxyapatite binding.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10640428 2000 Activation of integrin alpha(V)beta(3) regulates cell adhesion and migration to bone sialoprotein.
8406493 1993 The human bone sialoprotein gene (IBSP): genomic localization and characterization.
8401509 1993 The development of sequence-tagged sites for human chromosome 4.
8061918 1994 Characterization of the human bone sialoprotein (BSP) gene and its promoter sequence.
3597437 1987 Purification and partial characterization of small proteoglycans I and II, bone sialoproteins I and II, and osteonectin from the mineral compartment of developing human bone.
2461939 1988 Identification of a bone sialoprotein receptor in osteosarcoma cells.
2404984 1990 Human bone sialoprotein. Deduced protein sequence and chromosomal localization.