Property Summary

NCBI Gene PubMed Count 249
PubMed Score 1637.57
PubTator Score 1407.42

Knowledge Summary

Patent

No data available

Gene RIF (213)

PMID Text
26960140 Hsp72 (HSPA1A) prevents h-IAPP aggregation and toxicity.
26953503 Data suggest that IAPP/membrane interaction strongly depends on protonation state of His18; at neutral pH, N-terminal domain is stabilized/anchored to membrane, while C-terminal domain is disordered as if in solution.
26786104 These data suggest participation by both soluble and fibrillar aggregates in IAPP-induced islet inflammation. IAPP-induced activation of TLR2 and secretion of IL-1 may be important therapeutic targets to prevent amyloid-associated beta cell dysfunction.
26777153 The intramolecular hydrogen bond formation by His(18) and the possibility of His(18) participating in the formation of alpha-helical structures greatly modulated the manner of hIAPP amyloid formation.
26607804 the effect of the endoplasmic reticulum chaperone protein disulfide isomerase (PDI) on beta-cell dysfunction, was examined.
26603575 combined computational and experimental study offers detailed mechanistic insight into the complex role of zinc on IAPP aggregation and T2D development
26483547 Matrix Metalloproteinase-9 Protects Islets from Amyloid-induced Toxicity.
26352401 When copper(II) was present in the solution, no dimers were detected. Thus, the copper(II) ions disrupt the association pathway to the formation of beta-sheet rich amylin fibrils.
26331261 structural and dynamical information of amylin and CGRP
26263128 Study focused on human islet amyloid polypeptide aggregates and a de novo designed short polypeptide at lipid/water and air/glass interfaces; found that parallel beta-sheets adopt distinct orientations at various interfaces and exhibit characteristic chiroptical responses in the amide I and N-H stretch regions.
26221949 Secondary Structure of Rat and Human Amylin
26173078 The computational models support the cross-sequence interactions between ABETA and IAPP pentamers, which would lead to the complex hybrid ABETA-IAPP assemblies.
25966003 Taken together, these findings imply that membrane binding per se is insufficient to generate cytotoxicity; instead, enhanced sampling of rare states within the membrane-bound ensemble may potentiate IAPP's toxic effects.
25952953 Surface molecular structure and amino acid residue composition of hIAPP fibrils are specifically probed with nanoscale resolution using tip-enhanced Raman spectroscopy.
25922077 interaction between HS and IAPP or the subsequent effects represent a possible therapeutic target whose blockage can lead to a prolonged survival of beta cells
25913357 Structural studies and cytotoxicity assays of "aggregation-prone" IAPP(8-16) and its non-amyloidogenic variants suggest its important role in fibrillogenesis and cytotoxicity of human amylin.
25903685 Computational studies identified new IAPP mutations that have stronger amyloid fibrils destabilizing potential that the currently known.
25706385 cross-seeding assemblies between hIAPP and rIAPP oligomers
25649462 Inhibition of IAPP aggregation by insulin depends on the insulin oligomeric state regulated by zinc ion concentration
25495656 Study revealed that cholesterol slightly affects the aggregational and conformational behavior of hIAPP, and the affinity of hIAPP for cholesterol is significantly smaller than that for anionic lipids.
25494791 Graphene nanosheets can easily and quickly win a competitive adsorption of human islet amyloid polypeptides (hIAPP22-28) and associated fibrils against cell membrane, due to graphene's two-dimensional, hydrophobic surface.
25427619 The effect of a single proline mutant at position 26 in an amylin polypeptide on its binding to a lipid bilayer was studied.
25409149 deletion of the DeltaN isoforms of p63 or p73 leads to metabolic reprogramming and regression of p53-deficient tumours through upregulation of IAPP, the gene that encodes amylin, a 37-amino-acid peptide co-secreted with insulin by the beta cells of the pancreas
25342134 found by global gene expression profiling that BACE2 was up-regulated in the rat pancreatic beta-cell line INS1E stably transfected with human IAPP gene
25224501 A number of pathophysiological changes of the T2DM islet can be related to the amyloidogenic properties of hIAPP
25146704 There was abundant amylin aggregates in lysates of cardiac myocytes from obese patients, but not in controls. amylin aggregation at the sarcolemma induces oxidative stress and Ca(2+) dysregulation.
25080969 Mass spectrometric investigations show that copper(II) induces significant changes in the amylin structure, which decrease the protein fibrillogenesis.
25036708 Induction of high levels of human IAPP in mouse beta cells resulted in accumulation of this amyloidogenic protein as relatively inert fibrils within cytosolic p62-positive inclusions, which temporarily averts formation of toxic oligomers.
25036706 increased insulin resistance in combination with reduced autophagy may enhance the toxic potential of IAPP and enhance beta cell dysfunction and progression of T2DM
25036705 In mice with beta cell-specific expression of human IAPP, a deficiency in autophagy resulted in development of overt diabetes, which was not observed in mice expressing human IAPP alone or lacking autophagy alone.
25010593 the role of chaperones in a stressed cellular model of hIAPP overexpression
24928165 These results demonstrate the ability of the engineered beta-wrapin HI18 for shielding the hydrophobic sequence of IAPP during expression and purification
24898659 The study showed a positive relationship between plasma amylin levels and cognitive domains including memory, visuospatial ability and executive function.
24896327 Studies indicate that in addition to circulating amylin, amylin has been found to be synthetized de novo in the brain.
24879150 given that deficiency in UCHL1 exacerbated the defective autophagy/lysosomal degradation characteristic of IAPP proteotoxicity, we demonstrate a previously unrecognized role of UCHL1 in the function of the autophagy/lysosomal pathway in beta-cells
24825179 Introducing the porcine insulin promoter-hIAPP expression vector into PK15 cells combined with exogenous Pdx-1, MafA and NeuroD1 resulted in the efficient expression of hIAPP at the gene level, but not the protein.
24739876 Results indicate that (-)-epigallocatechin-3-gallate (EGCG) destabilized the islet amyloid polypeptide (hIAPP1-37) oligomers.
24703313 Analysis shows that interactions involving His-18 and the C-terminus Tyr are not essential for amyloid formation and, furthermore, shows that disrupting this potential interaction in both backgrounds enhances the rate of amyloid formation
24671002 Plasma levels of IAPP and insulin deviate in a subpopulation of young with newly-diagnosed type 1 diabetes.
24551113 The mechanical properties of human islet amyloid polypeptide (hIAPP) fibrils with respect to their molecular structures as well as their amino acid sequence, were characterized.
24520345 The presence of ApoE4 may attenuate amylin's capacity to remove Abeta, especially Abeta1-40, from the Alzheimer's disease brain.
24410108 In the critically ill amylin, concentrations are not elevated and not associated with feed intolerance
24352606 The study combines atomistic simulations and experiments to demonstrate a broad range of conformational states of IAPP double channels in lipid membranes. All individual channels display high selectivity for Cl(-) ions over cations.
24338965 C-peptide-insulin and IAPP-insulin interactions are mediated by a defined binding site, while such a feature is not apparent in the IAPP-C-peptide association.
24268144 the stability and orientation of membrane-embedded aggregates of the human islet amyloid polypeptide
24028418 The stability, conformational dynamics and association force of different single-layer models of the full-length wild-type and glycine mutants of amylin, were investigated.
24010666 effect of proline substitutions on the conformation of the hIAPP monomer
24009497 Studied the structure of two species of aggregating IAPP (human&cat)and two non-aggregating(pig&rat). Simulations suggest that the hairpin structure, only observed in the aggregating species, may be linked to the pathological role of this peptide.
23796517 A molecular mechanism for differential Pdx1 affinity to elements from the insulin and iapp promoter sequences.
23614446 The findings presented in this work suggest that the inter-conversion of amylin between an alpha-helix and a beta-hairpin is an activated process and could constitute the nucleation event for fibril growth.
23611340 His18 residue of IAPP binds heme under physiological conditions and results in an axial high-spin active site with a trans-axial water derived ligand.
23493869 Owing to the presence of various types of osmolytes in the cellular environment, this study focuses on the impact of stabilizing (trimethylamine N-oxide and betaine) and destabilizing (urea) cosolvents on the aggregation and fibrillation of IAPP.
23493863 The data indicate minimal membrane disruption by both human and rat-IAPP20-29 when compared to the full-length IAPP peptide.
23458258 Studies indicate residue-specific information about amyloid intermediate states of IAPP, alpha-synuclein, and tau were characerized with Forster resonance energy transfer (FRET).
23457571 the secondary structure of amylin in amyloid fibrils
23380070 Studies indicate that mutations in the putative helical region alter the rate of amyloid formation.
23337872 Studies indicate that IAPP is one of the most amyloidogenic sequences known.
23332070 the presence of Ca(2+) ions inhibits membrane damage occurring immediately after the interaction of freshly dissolved hIAPP with the membrane.
23267797 Rosiglitazone treatment of recipients of amyloid forming islets may not improve transplantation outcomes.
23261986 amylin directly stimulates fat cells, potentiates the effects of insulin and may influence insulin resistance.
23256729 The ability of all single aromatic to leucine mutants, all double aromatic to leucine mutants, and the triple leucine mutant to form amyloid were examined.[IAPP]
23229921 Results indicate the incorporation of electron donating groups on the aromatic ring of Phe-23 virtually abolish the ability of hIAPP22-29 to form amyloid.
23229548 MMP-9 constitutes an endogenous islet protease that limits islet amyloid deposition and its toxic effects via degradation of hIAPP.
23225004 Islet amyloid polypeptide: aggregation and fibrillogenesis in vitro and its inhibition.
23145779 The study reports a series of molecular dynamics simulations of two asymmetric polymorphs of the amylin fibril models.
23016872 The kinetics of IAPP amyloid formation are strongly dependent on ionic strength, varying by a factor of >10 over the range of 20-600 mM NaCl at pH 8.0, but the effect is not entirely due to Debye screening.
22944668 antimicrobial activity of human islet amyloid polypeptide against clinically relevant bacteria
22876830 The results obtained in this study using model membranes reveal that membrane-bound IAPP species display a pronounced membrane perturbation ability and suggest the potential involvement of the oligomeic forms of IAPP in membrane dysfunction.
22781911 Letter: report islet amyloid polypeptide amyloidosis in Japanese subjects with/without type 2 diabetes mellitus.
22734583 Deamidation accelerates amyloid formation and the deamidated material is able to seed amyloid formation by unmodified amylin.
22693597 insight into the hIAPP-membrane interaction and the molecular mechanism of membrane disruption by hIAPP oligomers
22542527 postulate that the engineered forms of NUCB1 prevent hIAPP fibril formation by a mechanism where protofibril-like species are "capped" to prevent further fibril assembly and maturation
22404928 the effects of hIAPP on lipid bilayers
22334700 C4BP binds to IAPP thereby limiting complement activation and may be enhancing formation of IAPP fibrils from cytotoxic oligomers
22325282 sequence-dependent mechanical propertie
22210153 The authors show that the human islet amyloid polypeptide aggregates bind at lipid/aqueous interfaces with beta-strands oriented at 48 degrees relative to the interface.
22206987 S20K mutant forms amyloid with an 18-fold longer lag phase in homogeneous solution. Thioflavin T binding assays, together with experiments using a p-cyanophenylalanine variant of human IAPP, show that S20K mutant inhibits amyloid formation by human IAPP
22193043 aggregation of islet amyloid polypeptide might be an important cause of progressing beta-cell dysfunction in clinically transplanted islets
22187437 local secondary structure and the relative orientation of the secondary structure elements
22135135 This study provides a mechanistic insight into the kinetic evolution of cell-toxic assemblies in mixtures of ABETA with the highly amyloidogenic IAPP under cellular membrane-like conditions.
22120172 The study uses mass-action kinetics and scaling analysis to reconstruct the amyloid aggregation pathway, and find that the initiation step requires four IAPP monomers.
22106265 Data show that duplex folding structures in islet amyloid polypeptide (hIAPP(8-37) assembly were observed featuring a hairpin structure.
22038516 Data suggest that aggregation of islet amyloid polypeptide as islet amyloid increases mRNA levels of markers of extrinsic and intrinsic apoptotic pathways in beta cells in a JNK-dependent manner.
22003494 By tuning the IAPP/insulin ratio, atomic force microscopy reveals the resulting nanostructure morphology changes from fibrils to oligomers, to annular.
21984830 hIAPP overexpression inhibits insulin and IAPP secretion in response to glucose affecting the activity of K(ATP) channels
21947943 Beta-Amyloid protein and amylin regulated apoptotic genes through the amylin receptor.
21935471 Study suggests that amylin is strongly associated with inflammatory markers and MetS.
21916515 Presented is a study of IAPP fibril by theoretical and experimental two-dimensional infrared spectroscopy, combined with atomistic molecular dynamics simulations.
21865171 an actin-mediated and cholesterol-dependent mechanism for selective uptake and clearance of amylin oligomers, impairment of which greatly potentiates amylin toxicity.
21742788 IAPP fibrils or oligomers have a crucial role in the progressive failure of beta-cells in transplants and thereby also indirectly support a similar mechanism in type 2 diabetes. (review)
21695120 These findings point to a potential for Drosophila melanogaster to serve as a model system for studies of hproIAPP and hIAPP expression with subsequent aggregation and developed pathology.
21633185 All islets from type 1 diabetics show less insulin cells and less IAPP positive cells with 2X glucagon/somatostatin cells of control; some insulin-negative cells were IAPP positive, suggesting presence of IAPP in degenerating/regenerating islets.
21616080 Zinc inhibits the formation of the IAPP dimer and mature fiber while promoting the formation of oligomers; IAPP binds to zinc as a hexamer by minimizing unfavorable steric interactions.
21606325 Data show that IAPP oligomeric species that arise through stochastic nucleation on membranes and result in disruption of the lipid bilayer.
21566116 Hexafluoroisopropanol induces amyloid fibrils of islet amyloid polypeptide by enhancing both hydrophobic and electrostatic interactions.
21555785 Short heparin fragments containing two- or eight-saccharide monomers protect against amylin cytotoxicity toward a MIN6 mouse cell model of pancreatic beta-cells.
21391619 Results show the importance of secondary nucleation in the fibrillization of amylin, as this could provide a pathway to continue fibril growth once an initial population of fibrils is established.
21281583 These results suggest that insulin has a more complicated role in inhibiting IAPP fibrillogenesis, and that other factors, such as the low pH of the secretory granule, may also play a role.
21266924 In a postprandial state, prolonged exercise stimulates glucagon and cortisol increases that are associated with stable blood glucose and leptin concentrations; insulin, C-peptide, and amylin concentrations decline.
21266296 The study is comparing the structural properties of human and rat islet amyloid polypeptide by MD computer simulations at 310 and 330 K and shows the effect of the disulfide bridge on the conformation of IAPP.
21219896 IAPP gene locus may not be useful predictor for type 2 diabetes mellitus risk assessment
21158384 Structural polymorphism of human islet amyloid polypeptide (hIAPP) oligomers highlights the importance of interfacial residue interactions
21148563 The molecular basis of distinct aggregation pathways of islet amyloid polypeptide.
21138812 Human amylin may not produce any significant effect on perfusion pressure, heart rate and contractility in isolated, perfused rat hearts.
21130765 Data indicated that a novel stable dimer was observed in pIAPP(20-29) solution, whereas hIAPP(20-29) exists mostly as monomers and trimers.
20923655 The conformational preferences of human amylin monomer in solution is reported using molecular simulations and infrared experiments.
20887731 aggregation kinetics, seeding ability, morphology, conformation, stability, and toxicity of amyloid fibrils formed by a 20-residue domain of the islet amyloid polypeptide (IAPP), as well as of a backward and scrambled version of this peptide
20814419 The scaffold protein p62 that delivers polyubiquitinated proteins to autophagy may have a protective role against human-IAPP-induced apoptosis.
20809197 The aromatic residues of the islet amyloid polypeptide fragment LANFLVH are capable of affecting the self-assembly kinetics of the peptides and peptide-membrane interactions, but they are not essential either for amyloid formation or membrane leakage.
20807286 Data show that BChE interacts with amylin through its core domain and efficiently attenuates both amylin fibril and oligomer formation.
20735358 Data show that HSP70, GRP78/BiP and HSP40/DnaJ each independently suppressed hA misfolding.
20630475 Fluorescence emission measurements, infrared measurements, and quenching studies indicate that the aromatic residues are differentially exposed in the fibril state with Phe15 being the most exposed.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20579740 Data show that the abolition by Cu(II) of the propensity of ProIAPP(1-48) to form amyloid may have important implications for the treatment of T2DM.
20536124 Zinc, which is found at millimolar concentrations in the secretory granule, significantly inhibits hIAPP amyloid fibrillogenesis at concentrations similar to those found in the extracellular environment.
20509034 Proamylin may play an important role in amyloid deposit in patients with impaired glucose regulation and type 2 diabetes.
20429571 the absence of the disulfide bond greatly decreases the extent of the IAPP helix formed throughout residues 5-9 in favor of random coil and beta-sheet structure.
20421596 The study found IAPP in non-diabetic pancreata, whereas diabetic pancreata showed variable IAPP expression.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20186753 show that both A beta and human amylin (HA) deregulate identical proteins, a quarter of which are mitochondrial, supporting the notion that mitochondrial dysfunction is a common target in these two amyloidoses.
20028124 Although human IAPP is extremely amyloidogenic, human IAPP fibrils do not seed amyloid formation by rat IAPP.
19948124 these newly observed differences between human and rat amylin in solution and their possible relation to aggregation and to the physiological function of amylin binding to the calcitonin receptor
19931436 Decreased secretion of amylin may be a mechanism through which reduced nutrient intake adversely affects bone mineral density in women with anorexia nervosa.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19817482 This study suggests that the hIAPP precursors prohIAPP and prohIAPP(1-48) do not serve as amyloid initiators but rather prevent aggregation and membrane damage of mature hIAPP in early stages of its biosynthesis and intracellular transport.
19810772 annexin A5 is coexpressed in human beta-cells and that exogenous annexin A5 reduces the level of h-IAPP-induced apoptosis in human islets by approximately 50% and in rodent beta-cells by approximately 90%
19794060 Tetracycline suppresses the misfolding of human IAPP in transgenic mice, and may be able to prevent the ensuing type ii diabetes.
19720065 The modulatory effect of cholesterol was largely independent of membrane charge or phospholipids, suggesting a novel cholesterol-regulated amylin polymerization process.
19647738 Data demonstrate that gangliosides play an essential role in the formation of amyloid deposits by human IAPP on plasma membranes.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19573128 gene is unlikely to have a significant role in monogenic diabetes in humans
19554505 Amylin is expressed in the human placenta and is regulated by nutritional status.
19538245 mutations of hIAPP gene are not a common cause of neonatal/infancy/childhood-onset diabetes
19427320 The authors show that in the presence of negatively charged membranes, proIAPP exhibits a much higher amyloidogenic propensity than in bulk solvent.
19402658 study of the conformational ensembles of IAPP segment 15-27 in both wild type and the S20G mutant type; results reveal that the residue G20 initiates a turnlike structure in the neighborhood, facilitating the formation of long-ranged contacts
19346479 This experimental approach provides a detailed view of the aggregation pathway of hIAPP fibril formation.
19338997 There is a significant positive correlation between amylin and insulin levels at fasting both in women with polycystic ovary syndrome and controls, but amylin did not correlate with fasting glucose levels.
19244249 Dynamic alpha-helix structure of micelle-bound human amylin.
19151199 Human IAPP transgenic rats show resustance to increasted beta cell mass and and can adapt to high-fat diets.
19148619 When transfected into mice, induces oxidative stress, which may feed back to further exacerbate amyloid formation and contribute to beta cell apoptosis.
19146426 This His/Arg-18 mutation results in reduced affinity binding of human IAPP to insulin in comparison to rat IAPP.
19002432 When present in transgenic mice, amyloid formation results in recurrence of hyperglycaemia.
18989933 results indicate that the modulation of the peptide orientation in the membrane by His18 plays a key role in the toxicity of nonamyloidogenic forms of hIAPP
18989932 NMR structures of the human and rat IAPP(1-19) peptides in DPC micelles
18815541 Report higher islet amyloid load in men than in women with type 2 diabetes mellitus.
18751967 Decreasing the activity of TRPV4 prevented human islet amyloid polypeptide (hIAPP)-induced [Ca(2+)](i) changes, reduced hIAPP-triggered ER stress and improved cell viability
18710262 the amyloidogenicity of amylin and its processing intermediates in vitro.
18624122 Amylin is clearly involved in glucose homeostasis through the inhibition of gastric emptying and postprandial hepatic glucose production, eventually reducing postprandial glucose excursions.
18615201 The reduced glucagon response to protein challenge may reflect a direct inhibitory influence of hIAPP on glucagon secretion.
18556473 Atomic structure of the cross-beta spine of amyloid polypeptide (amylin) is reported.
18497871 To investigate the roles of hIAPP and islet amyloidosis in type 2 diabetes mellitus, transgenic mice expressing hIAPP in their islet beta cells were generated.
18486611 Amylin shares neurotoxic properties with Abeta42.
18483616 Review the interaction of hIAPP with membranes, with a focus on hIAPP structure and on the proposed mechanisms of hIAPP-induced membrane damage in relation to beta-cell death in type 2 diabetes mellitus.
18408164 These observations point toward a mechanism in which growth of hIAPP fibrils, rather than a particular hIAPP species, is responsible for the observed membrane damage in type 2 diabetes mellitus.
18291688 The effects of (1-40)betaA and (25-35)betaA peptides on human amylin (hA)-mediated cell death and [(125)I-Tyr(37)]hA precipitation, was investigated.
17911343 Findings indicate the pancreatic beta-cell toxic effects of hIAPP depend on the propensity of IAPP to aggregate, but not on the consequence of protein overexpression.
17804609 Using IAPP transgenic mice, interventions that decreased both glycosaminoglycan synthesis and O-linked protein glycosylation reduced islet amyloid formation.
17722920 findings show that the I26P point mutatnt had a profound effect on the ability of hIAPP to form amyloid; the I26P point mutant was also a potent inhibitor of wild-type fibrillization
17660321 Dynamic conformational changes observed for negatively charged lipid interfaces play an important role as the first steps of IAPP-induced membrane damage in type II diabetes.
17617411 formation of hydrogen peroxide from amylin could contribute to the progressive degeneration of islet cells in type-2 diabetes mellitus
17563070 Endoplasmic reticulum stress responses are intracellular signaling mechanisms induced by extracellular hIAPP aggregation and theubiquitin-proteasome pathway is implicated.
17495860 found renal amylin deposition in patients with diabetic nephropathy and the deposition was associated with disease severity
17475933 endoplasmic reticulum stress is a mechanism by which IAPP induces beta-cell apoptosis
17353506 In human IAPP transgenic mouse models,anti-toxic oligomer antibodies do not prevent IAPP-induced beta-cell apoptosis.
17213278 Amylin levels and hypertension may be linked by a novel mechanism involving the capacity of amylin to induce endothelial dysfunction in type 2 diabetes.
17212787 We found a structural similarity between a typical glycolipid-binding domain (the V3 loop of HIV-1 gp120) and the minimal amyloid-forming fragment of the human islet amyloid polypeptide, i.e. the octapeptide core module NFGAILSS
17123962 While optical spectroscopy shows IAPP to be natively unfolded, NMR chemical shifts of backbone and beta-carbon resonances reveal the sampling of alpha-helical states across a continuous stretch comprising approximately 40% of the protein.
16950544 Observational study of genotype prevalence. (HuGE Navigator)
16950544 No mutation in IAPP was found in the Mexican Mestizo population.
16866369 The heparin binding site in the N-terminus of IAPP precursor is characterized in detail, and an important role for the IAPP Cys-13/Cys-18 disulfide bridge in heparin binding is demonstrated.
16804082 The HIP rat, a human IAPP transgenic rat model that develops islet pathology comparable to humans with type 2 diabetes.
16403520 IAPP monomers might insert with high efficiency in biological membranes in vivo; this process could play an important role as a first step in IAPP-induced membrane damage in type 2 diabetes.
16331989 Results describe the role of Histidine-18 in amyloid formation by human islet amyloid polypeptide.
16303136 The amino acid residues 20-29 region of IAPP was tested for amyloidogenic domain.
16204373 In human islets, activation of PPAR-gamma inhibits h-IAPP-induced islet cell apoptosis, and this action is at least in part mediated through activation of the phosphatidylinositol 3'-kinase-Akt cascade.
16142909 conditions that promote weakly stable alpha-helical conformations may promote IAPP aggregation
15983227 Rosiglitazone and metformin protect beta-cells from the deleterious effects of islet amyloid, and this effect may contribute to the ability of these treatments to alleviate the progressive loss of beta-cell mass and function in type 2 diabetes.
15929864 Oligomeric IAPP assemblies exert toxic effects on beta cells that die, leading to reduced beta-cell mass. (review)
15878744 Observational study of gene-disease association. (HuGE Navigator)
15878744 Genetic polymorphism of the islet amyloid polypeptide gene promoter region is not associated with type 2 diabetes or islet amyloidosis.
15811365 protein structure of amylin (as a model for amyloid fibrils)
15778964 Structural analysis of the clusters clearly suggested the formation of "flat" ellipsoid-shaped clusters through a preferred locally parallel alignment of the peptides in water.
15710403 findings are consistent with the hypothesis that membrane-active pre-fibrillar hIAPP oligomers insert into beta cell membranes in NIDDM
15638806 Structure of the amylin fibrils was studied using atomic force microscopy.
15527771 process of hIAPP amyloid formation is accompanied by a loss of barrier function, whereby lipids are extracted from the membrane and taken up in the forming amyloid deposits
15358791 Data are consistent with a parallel arrangement of islet amyloid polypeptide (IAPP) peptides within the amyloid fibril.
15342243 interaction between lipid bilayers and the 37 amino acid residue polypeptide amylin, which is the primary constituent of the pancreatic amyloid associated with type 2 diabetes
15321714 Results describe the interactions of islet amyloid polypeptide (IAPP) with phospholipid bilayers and the morphological effects of membranes on IAPP fibers.
15292167 this study reports the expression, purification and characterization of the amyloidogenicity and cytotoxicity of recombinant human mature IAPP
14659752 the dominant effect of insulin is to act on the elongation portion of the fiber formation reaction
14656003 Amylin is widely expressed in non-tumorous pancreatic islets and in one insulin producing beta cell tumor
14578294 Islet amyloid deposits were identified using Congo red staining in islets of patients with NIDDM.
14532296 amylin has a role in evoking a JNK1-mediated apoptotic pathway, which is partially dependent and partially independent of caspase-8, and in which caspase-3 acts as a common downstream effector
12767835 role played by the hydrophobic and aromatic residues in inter-sheet association and fibril formation
12717720 conformational preferences of hIAPP(20-29) in membrane-mimicking environments
12717671 DAP 12 gene of chromosome 19q13.1 is implicated in Nasu Hakola disease
12706321 Observational study of gene-disease association. (HuGE Navigator)
12706321 The frequency of the S20G mutation in the amylin gene is 1.92% in unrelated Korean type 2 diabetic patients and this mutation is associated with a lower BMI and a higher HbA(1c) level.
12706318 IAPP is found in 90% of patients with NIDDM at post-mortem. More extensive amyloidosis is associated with decreased islet function and requirement for insulin therapy.
12679865 Observational study of gene-disease association. (HuGE Navigator)
12611974 Human amylin, like beta-Amyloid, is capable of modulating ion channel function in rat cholinergic basal forebrain neurons. The hAmylin effects could be occluded by beta-amyloid and vice versa.
12589759 Data show that the three specific proline residues in human and rat amylin play a dominant negative role in fibril formation.
12588049 Observational study of gene-disease association. (HuGE Navigator)
12588049 polymorphism of IAPP gene in nondiabetic subjects and type 2 diabetes is associated with lower levels of LDL cholesterol; abnormalities of coding regions or 5'-UTR not associated with type 2 diabetes or gestational diabetes mellitus in Spanish population.
12540610 Increased dietary fat promotes islet cell formation and dysfunction in transgenic mice models.
12441106 results suggest strongly that human amylin induces apoptosis in pancreatic islet beta-cells through stimulation of expression and activation of c-Jun
12367525 Results describe a novel molecular recognition motif within the human islet amyloid polypeptide (hIAPP) molecule.
12298020 Inhibition of amyloid fibril formation of human amylin by N-alkylated amino acid and alpha-hydroxy acid residue containing peptides
12221327 The presence of amylin-derived islet amyloid is felt to play a significant role in the remodeling of the endocrine pancreas as well as the natural progressive history of type 2 diabetes mellitus.
12086946 estrogen prevents or reverses obesity and diabetes in transgenic mice expressing the human gene
11979402 progressive intermittent exercise protocol of moderate to maximum exercise intensities stimulates increases in amylin levels
11786016 structure-based design and study of non-amyloidogenic, double N-methylated IAPP amyloid core sequences as inhibitors of IAPP amyloid formation and cytotoxicity
11318791 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY      1 - 70
GKRNAVEVLKREPLNYLPL                                                        71 - 89
//

Text Mined References (253)

PMID Year Title
26960140 2016 Hsp72 (HSPA1A) Prevents Human Islet Amyloid Polypeptide Aggregation and Toxicity: A New Approach for Type 2 Diabetes Treatment.
26953503 2016 Conformational Dynamics of the Human Islet Amyloid Polypeptide in a Membrane Environment: Toward the Aggregation Prone Form.
26922873 2016 Amylin-mediated control of glycemia, energy balance, and cognition.
26786104 2016 Differential Activation of Innate Immune Pathways by Distinct Islet Amyloid Polypeptide (IAPP) Aggregates.
26777153 2016 How the imidazole ring modulates amyloid formation of islet amyloid polypeptide: A chemical modification study.
26607804 2016 Protein disulfide isomerase ameliorates ?-cell dysfunction in pancreatic islets overexpressing human islet amyloid polypeptide.
26603575 2015 Promotion or Inhibition of Islet Amyloid Polypeptide Aggregation by Zinc Coordination Depends on Its Relative Concentration.
26483547 2015 Matrix Metalloproteinase-9 Protects Islets from Amyloid-induced Toxicity.
26352401 2015 Rapid assessment of human amylin aggregation and its inhibition by copper(II) ions by laser ablation electrospray ionization mass spectrometry with ion mobility separation.
26331261 2015 Slow Internal Dynamics and Charge Expansion in the Disordered Protein CGRP: A Comparison with Amylin.
26263128 2015 Characterization of Parallel ?-Sheets at Interfaces by Chiral Sum Frequency Generation Spectroscopy.
26221949 2015 Secondary Structure of Rat and Human Amylin across Force Fields.
26173078 2015 Polymorphic Associations and Structures of the Cross-Seeding of A?1-42 and hIAPP1-37 Polypeptides.
25966003 2015 Structure-Based Small Molecule Modulation of a Pre-Amyloid State: Pharmacological Enhancement of IAPP Membrane-Binding and Toxicity.
25952953 2015 Nanoscale Heterogeneity of the Molecular Structure of Individual hIAPP Amyloid Fibrils Revealed with Tip-Enhanced Raman Spectroscopy.
25922077 2015 Heparan Sulfate Proteoglycans Are Important for Islet Amyloid Formation and Islet Amyloid Polypeptide-induced Apoptosis.
25913357 2015 Structural studies and cytotoxicity assays of "aggregation-prone" IAPP(8-16) and its non-amyloidogenic variants suggest its important role in fibrillogenesis and cytotoxicity of human amylin.
25903685 2015 Computational re-engineering of Amylin sequence with reduced amyloidogenic potential.
25706385 2015 Interfacial interaction and lateral association of cross-seeding assemblies between hIAPP and rIAPP oligomers.
25649462 2015 Inhibition of IAPP aggregation by insulin depends on the insulin oligomeric state regulated by zinc ion concentration.
25495656 Cholesterol modulates the interaction of the islet amyloid polypeptide with membranes.
25494791 2014 Dewetting transition assisted clearance of (NFGAILS) amyloid fibrils from cell membranes by graphene.
25427619 2015 Free energy simulations of amylin I26P mutation in a lipid bilayer.
25409149 2015 IAPP-driven metabolic reprogramming induces regression of p53-deficient tumours in vivo.
25342134 2015 Inhibition of BACE2 counteracts hIAPP-induced insulin secretory defects in pancreatic ?-cells.
25224501 2014 Human IAPP amyloidogenic properties and pancreatic ?-cell death.
25146704 2014 Cardioprotection by controlling hyperamylinemia in a "humanized" diabetic rat model.
25080969 2014 The role of copper(II) in the aggregation of human amylin.
25036708 2014 Autophagy defends pancreatic ? cells from human islet amyloid polypeptide-induced toxicity.
25036706 2014 Human IAPP-induced pancreatic ? cell toxicity and its regulation by autophagy.
25036705 2014 Amyloidogenic peptide oligomer accumulation in autophagy-deficient ? cells induces diabetes.
25010593 2014 Chaperones ameliorate beta cell dysfunction associated with human islet amyloid polypeptide overexpression.
24928165 2014 Engineered aggregation inhibitor fusion for production of highly amyloidogenic human islet amyloid polypeptide.
24898659 2014 Positive association between plasma amylin and cognition in a homebound elderly population.
24896327 2014 Amylin in vasodilation, energy expenditure and inflammation.
24879150 2014 UCHL1 deficiency exacerbates human islet amyloid polypeptide toxicity in ?-cells: evidence of interplay between the ubiquitin/proteasome system and autophagy.
24825179 2014 The study of regulatory effects of Pdx-1, MafA and NeuroD1 on the activity of porcine insulin promoter and the expression of human islet amyloid polypeptide.
24739876 2014 Exploring the influence of EGCG on the ?-sheet-rich oligomers of human islet amyloid polypeptide (hIAPP1-37) and identifying its possible binding sites from molecular dynamics simulation.
24703313 2014 Mutational analysis of preamyloid intermediates: the role of his-tyr interactions in islet amyloid formation.
24671002 2014 High plasma levels of islet amyloid polypeptide in young with new-onset of type 1 diabetes mellitus.
24561193 2014 A hIAPP-derived all-D-amino-acid inhibits hIAPP fibrillation efficiently at membrane surface by targeting ?-helical oligomeric intermediates.
24551113 2014 Role of sequence and structural polymorphism on the mechanical properties of amyloid fibrils.
24520345 2014 Association between amylin and amyloid-? peptides in plasma in the context of apolipoprotein E4 allele.
24410108 2014 Endogenous amylin and glucagon-like peptide-1 concentrations are not associated with gastric emptying in critical illness.
24352606 2014 Non-selective ion channel activity of polymorphic human islet amyloid polypeptide (amylin) double channels.
24338965 2014 Insulin, islet amyloid polypeptide and C-peptide interactions evaluated by mass spectrometric analysis.
24268144 2013 Membrane permeation induced by aggregates of human islet amyloid polypeptides.
24042052 2013 Blockade of islet amyloid polypeptide fibrillation and cytotoxicity by the secretory chaperones 7B2 and proSAAS.
24028418 2014 Full length amylin oligomer aggregation: insights from molecular dynamics simulations and implications for design of aggregation inhibitors.
24010666 2013 Effect of proline mutations on the monomer conformations of amylin.
24009497 2013 Structural similarities and differences between amyloidogenic and non-amyloidogenic islet amyloid polypeptide (IAPP) sequences and implications for the dual physiological and pathological activities of these peptides.
23796517 2013 Thermodynamic and structural determinants of differential Pdx1 binding to elements from the insulin and IAPP promoters.
23614446 2013 ?-helix to ?-hairpin transition of human amylin monomer.
23611340 2013 Heme bound amylin: spectroscopic characterization, reactivity, and relevance to type 2 diabetes.
23493869 2013 Cosolvent effects on the fibrillation reaction of human IAPP.
23493863 2013 Membrane disordering is not sufficient for membrane permeabilization by islet amyloid polypeptide: studies of IAPP(20-29) fragments.
23458258 2013 A flash in the pan: dissecting dynamic amyloid intermediates using fluorescence.
23457571 2013 Amide proton solvent protection in amylin fibrils probed by quenched hydrogen exchange NMR.
23380070 2013 Islet amyloid: from fundamental biophysics to mechanisms of cytotoxicity.
23337872 2013 Mechanisms of islet amyloidosis toxicity in type 2 diabetes.
23332070 2013 Cations as switches of amyloid-mediated membrane disruption mechanisms: calcium and IAPP.
23267797 2013 Rosiglitazone treatment does not decrease amyloid deposition in transplanted islets from transgenic mice expressing human islet amyloid polypeptide.
23261986 2013 Amylin stimulates fatty acid esterification in 3T3-L1 adipocytes.
23256729 2013 Role of aromatic interactions in amyloid formation by islet amyloid polypeptide.
23229921 2013 Evidence of ?-stacking interactions in the self-assembly of hIAPP(22-29).
23229548 2013 Matrix metalloproteinase-9 reduces islet amyloid formation by degrading islet amyloid polypeptide.
23225004 2012 Islet amyloid polypeptide: aggregation and fibrillogenesis in vitro and its inhibition.
23145779 2012 Molecular dynamics simulation study on the molecular structures of the amylin fibril models.
23016872 2012 Ionic strength effects on amyloid formation by amylin are a complicated interplay among Debye screening, ion selectivity, and Hofmeister effects.
22944668 2012 Antimicrobial activity of human islet amyloid polypeptides: an insight into amyloid peptides' connection with antimicrobial peptides.
22876830 2012 Binding of islet amyloid polypeptide to supported lipid bilayers and amyloid aggregation at the membranes.
22781911 2012 The occurrence of islet amyloid polypeptide amyloidosis in Japanese subjects.
22734583 2012 Deamidation accelerates amyloid formation and alters amylin fiber structure.
22693597 2012 Lipid interaction and membrane perturbation of human islet amyloid polypeptide monomer and dimer by molecular dynamics simulations.
22542527 2012 Nucleobindin 1 caps human islet amyloid polypeptide protofibrils to prevent amyloid fibril formation.
22404928 2012 How type II diabetes-related islet amyloid polypeptide damages lipid bilayers.
22334700 2012 Islet amyloid polypeptide triggers limited complement activation and binds complement inhibitor C4b-binding protein, which enhances fibril formation.
22325282 2012 Effect of sequence variation on the mechanical response of amyloid fibrils probed by steered molecular dynamics simulation.
22210153 2012 Amphiphilic adsorption of human islet amyloid polypeptide aggregates to lipid/aqueous interfaces.
22206987 2012 Sensitivity of amyloid formation by human islet amyloid polypeptide to mutations at residue 20.
22193043 2012 Further evidence for amyloid deposition in clinical pancreatic islet grafts.
22187437 2012 Fibril structure of human islet amyloid polypeptide.
22135135 2012 Cross-amyloid interaction of A? and IAPP at lipid membranes.
22120172 2011 Reverse engineering an amyloid aggregation pathway with dimensional analysis and scaling.
22106265 2011 Beta structure motifs of islet amyloid polypeptides identified through surface-mediated assemblies.
22038516 2012 cJUN N-terminal kinase (JNK) activation mediates islet amyloid-induced beta cell apoptosis in cultured human islet amyloid polypeptide transgenic mouse islets.
22003494 2012 Co-assembly of human islet amyloid polypeptide (hIAPP)/insulin.
21984830 2011 Involvement of ATP-sensitive potassium (K(ATP)) channels in the loss of beta-cell function induced by human islet amyloid polypeptide.
21947943 2012 ?-Amyloid protein (A?) and human amylin regulation of apoptotic genes occurs through the amylin receptor.
21935471 2011 Associations of amylin with inflammatory markers and metabolic syndrome in apparently healthy Chinese.
21916515 2011 2DIR spectroscopy of human amylin fibrils reflects stable ?-sheet structure.
21865171 2011 Clustering and internalization of toxic amylin oligomers in pancreatic cells require plasma membrane cholesterol.
21742788 2011 Islet amyloid polypeptide, islet amyloid, and diabetes mellitus.
21695120 2011 Drosophila melanogaster as a model system for studies of islet amyloid polypeptide aggregation.
21633185 Islet amyloid polypeptide in pancreatic islets from type 1 diabetic subjects.
21616080 2011 A two-site mechanism for the inhibition of IAPP amyloidogenesis by zinc.
21606325 2011 Islet amyloid polypeptide demonstrates a persistent capacity to disrupt membrane integrity.
21566116 2011 Hexafluoroisopropanol induces amyloid fibrils of islet amyloid polypeptide by enhancing both hydrophobic and electrostatic interactions.
21555785 2011 Mechanism of amylin fibrillization enhancement by heparin.
21391619 2011 Heterogeneous amylin fibril growth mechanisms imaged by total internal reflection fluorescence microscopy.
21281583 2011 Biphasic effects of insulin on islet amyloid polypeptide membrane disruption.
21266924 2011 Amylin and selective glucoregulatory peptide alterations during prolonged exercise.
21266296 2011 Comparing the structural properties of human and rat islet amyloid polypeptide by MD computer simulations.
21219896 2011 Islet amyloid polypeptide gene variation (IAPP) and the risk of incident type 2 diabetes mellitus: the Women's Genome Health Study.
21158384 2011 Structural polymorphism of human islet amyloid polypeptide (hIAPP) oligomers highlights the importance of interfacial residue interactions.
21148563 2011 The molecular basis of distinct aggregation pathways of islet amyloid polypeptide.
21138812 2010 Positive inotropic, positive chronotropic and coronary vasodilatory effects of rat amylin: mechanisms of amylin-induced positive inotropy.
21130765 2011 Porcine islet amyloid polypeptide fragments are refractory to amyloid formation.
20923655 2010 Stable and metastable states of human amylin in solution.
20887731 2010 The role of protein sequence and amino acid composition in amyloid formation: scrambling and backward reading of IAPP amyloid fibrils.
20814419 2011 Human-IAPP disrupts the autophagy/lysosomal pathway in pancreatic ?-cells: protective role of p62-positive cytoplasmic inclusions.
20809197 2011 The role of aromatic side-chains in amyloid growth and membrane interaction of the islet amyloid polypeptide fragment LANFLVH.
20807286 2011 Butyrylcholinesterase interactions with amylin may protect pancreatic cells in metabolic syndrome.
20735358 2010 The chaperone proteins HSP70, HSP40/DnaJ and GRP78/BiP suppress misfolding and formation of ?-sheet-containing aggregates by human amylin: a potential role for defective chaperone biology in Type 2 diabetes.
20630475 2010 Residue-specific, real-time characterization of lag-phase species and fibril growth during amyloid formation: a combined fluorescence and IR study of p-cyanophenylalanine analogs of islet amyloid polypeptide.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20579740 2010 Human pro-islet amyloid polypeptide (ProIAPP(1-48)) forms amyloid fibrils and amyloid spherulites in vitro.
20536124 2010 Role of zinc in human islet amyloid polypeptide aggregation.
20509034 2010 Serum levels of proamylin and amylin in normal subjects and patients with impaired glucose regulation and type 2 diabetes mellitus.
20429571 2010 Effect of the disulfide bond on the monomeric structure of human amylin studied by combined Hamiltonian and temperature replica exchange molecular dynamics simulations.
20421596 2010 Pathologic changes and glucose homeostasis according to expression of human islet amyloid polypeptide in type 2 diabetic patients.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20186753 2010 Abeta and human amylin share a common toxicity pathway via mitochondrial dysfunction.
20028124 2010 The ability of rodent islet amyloid polypeptide to inhibit amyloid formation by human islet amyloid polypeptide has important implications for the mechanism of amyloid formation and the design of inhibitors.
19948124 2009 Evidence for a partially structured state of the amylin monomer.
19931436 2010 Reduced amylin levels are associated with low bone mineral density in women with anorexia nervosa.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19817482 2009 Impaired processing of human pro-islet amyloid polypeptide is not a causative factor for fibril formation or membrane damage in vitro.
19810772 2009 Annexin A5 directly interacts with amyloidogenic proteins and reduces their toxicity.
19794060 2010 Tetracycline treatment retards the onset and slows the progression of diabetes in human amylin/islet amyloid polypeptide transgenic mice.
19720065 2009 Cholesterol regulates assembly of human islet amyloid polypeptide on model membranes.
19647738 2009 Ganglioside-induced amyloid formation by human islet amyloid polypeptide in lipid rafts.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19573128 2009 Mutations in MAFA and IAPP are not a common cause of monogenic diabetes.
19554505 2009 Vaspin and amylin are expressed in human and rat placenta and regulated by nutritional status.
19538245 2009 Mutations in IAPP and NEUROG3 genes are not a common cause of permanent neonatal/infancy/childhood-onset diabetes.
19475663 2009 Atomic structures of IAPP (amylin) fusions suggest a mechanism for fibrillation and the role of insulin in the process.
19427320 2009 Amyloidogenic propensities and conformational properties of ProIAPP and IAPP in the presence of lipid bilayer membranes.
19402658 2009 Conformation preorganization: effects of S20G mutation on the structure of human islet amyloid polypeptide segment.
19346479 2009 Two-dimensional IR spectroscopy and isotope labeling defines the pathway of amyloid formation with residue-specific resolution.
19338997 2010 Increased secretion of amylin in women with polycystic ovary syndrome.
19244249 2009 Dynamic alpha-helix structure of micelle-bound human amylin.
19151199 2009 Successful versus failed adaptation to high-fat diet-induced insulin resistance: the role of IAPP-induced beta-cell endoplasmic reticulum stress.
19148619 2009 Oxidative stress is induced by islet amyloid formation and time-dependently mediates amyloid-induced beta cell apoptosis.
19146426 2009 Residual structure in islet amyloid polypeptide mediates its interactions with soluble insulin.
19002432 2009 Amyloid formation results in recurrence of hyperglycaemia following transplantation of human IAPP transgenic mouse islets.
18989933 2008 A single mutation in the nonamyloidogenic region of islet amyloid polypeptide greatly reduces toxicity.
18989932 2008 Structures of rat and human islet amyloid polypeptide IAPP(1-19) in micelles by NMR spectroscopy.
18815541 2008 Higher islet amyloid load in men than in women with type 2 diabetes mellitus.
18751967 2008 Calcium elevation in mouse pancreatic beta cells evoked by extracellular human islet amyloid polypeptide involves activation of the mechanosensitive ion channel TRPV4.
18710262 2008 Amylin proprotein processing generates progressively more amyloidogenic peptides that initially sample the helical state.
18624122 2008 [Role of amylin in glucose homeostasis and its perspective use in diabetes management].
18615201 2008 Disturbed alpha-cell function in mice with beta-cell specific overexpression of human islet amyloid polypeptide.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18556473 2008 Atomic structure of the cross-beta spine of islet amyloid polypeptide (amylin).
18497871 2008 Human islet amyloid polypeptide transgenic mice: in vivo and ex vivo models for the role of hIAPP in type 2 diabetes mellitus.
18486611 2008 Human but not rat amylin shares neurotoxic properties with Abeta42 in long-term hippocampal and cortical cultures.
18483616 2008 Recent insights in islet amyloid polypeptide-induced membrane disruption and its role in beta-cell death in type 2 diabetes mellitus.
18408164 2008 Membrane damage by human islet amyloid polypeptide through fibril growth at the membrane.
18291688 2008 Beta-amyloid peptides 1-40betaA and 25-35betaA suppress human amylin-mediated death of RINm5F islet beta-cells with distinct actions on fibril formation.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
17911343 2007 Induction of endoplasmic reticulum stress-induced beta-cell apoptosis and accumulation of polyubiquitinated proteins by human islet amyloid polypeptide.
17804609 2007 Inhibition of glycosaminoglycan synthesis and protein glycosylation with WAS-406 and azaserine result in reduced islet amyloid formation in vitro.
17722920 2007 A single-point mutation converts the highly amyloidogenic human islet amyloid polypeptide into a potent fibrillization inhibitor.
17660321 2007 Mechanism of islet amyloid polypeptide fibrillation at lipid interfaces studied by infrared reflection absorption spectroscopy.
17617411 2007 Copper-mediated formation of hydrogen peroxide from the amylin peptide: a novel mechanism for degeneration of islet cells in type-2 diabetes mellitus?
17563070 2007 Impairment of the ubiquitin-proteasome pathway is a downstream endoplasmic reticulum stress response induced by extracellular human islet amyloid polypeptide and contributes to pancreatic beta-cell apoptosis.
17495860 2007 Amylin deposition in the kidney of patients with diabetic nephropathy.
17475933 2007 High expression rates of human islet amyloid polypeptide induce endoplasmic reticulum stress mediated beta-cell apoptosis, a characteristic of humans with type 2 but not type 1 diabetes.
17374526 2007 Cloning and expression of human islet amyloid polypeptide in cultured cells.
17353506 2007 Toxic human islet amyloid polypeptide (h-IAPP) oligomers are intracellular, and vaccination to induce anti-toxic oligomer antibodies does not prevent h-IAPP-induced beta-cell apoptosis in h-IAPP transgenic mice.
17213278 2007 Amylin and hypertension: association of an amylin -G132A gene mutation and hypertension in humans and amylin-induced endothelium dysfunction in rats.
17212787 2006 The minimal amyloid-forming fragment of the islet amyloid polypeptide is a glycolipid-binding domain.
17123962 2007 Direct detection of transient alpha-helical states in islet amyloid polypeptide.
17051221 2006 Structures of human insulin-degrading enzyme reveal a new substrate recognition mechanism.
16950544 2007 Amylin S20G mutation in Mexican population.
16866369 2006 Characterization of the heparin binding site in the N-terminus of human pro-islet amyloid polypeptide: implications for amyloid formation.
16804082 2006 Beta-cell deficit due to increased apoptosis in the human islet amyloid polypeptide transgenic (HIP) rat recapitulates the metabolic defects present in type 2 diabetes.
16531504 2006 Distinct receptor activity-modifying protein domains differentially modulate interaction with calcitonin receptors.
16403520 2006 Islet amyloid polypeptide inserts into phospholipid monolayers as monomer.
16331989 2005 The role of His-18 in amyloid formation by human islet amyloid polypeptide.
16303136 2006 Destabilization of human IAPP amyloid fibrils by proline mutations outside of the putative amyloidogenic domain: is there a critical amyloidogenic domain in human IAPP?
16204373 2005 Activation of peroxisome proliferator-activated receptor-gamma by rosiglitazone protects human islet cells against human islet amyloid polypeptide toxicity by a phosphatidylinositol 3'-kinase-dependent pathway.
16142909 2005 Lipid membranes modulate the structure of islet amyloid polypeptide.
15983227 2005 Long-term treatment with rosiglitazone and metformin reduces the extent of, but does not prevent, islet amyloid deposition in mice expressing the gene for human islet amyloid polypeptide.
15929864 2005 Is aggregated IAPP a cause of beta-cell failure in transplanted human pancreatic islets?
15878744 2005 Islet amyloid polypeptide gene promoter polymorphisms are not associated with Type 2 diabetes or with the severity of islet amyloidosis.
15811365 2005 The parallel superpleated beta-structure as a model for amyloid fibrils of human amylin.
15778964 2005 Molecular dynamics simulation of the aggregation of the core-recognition motif of the islet amyloid polypeptide in explicit water.
15710403 2005 Neutron diffraction reveals sequence-specific membrane insertion of pre-fibrillar islet amyloid polypeptide and inhibition by rifampicin.
15638806 2005 Atomic force microscopy study of human amylin (20-29) fibrils.
15527771 2004 Islet amyloid polypeptide-induced membrane leakage involves uptake of lipids by forming amyloid fibers.
15522881 2005 Characterization of the Alzheimer's disease-associated CLAC protein and identification of an amyloid beta-peptide-binding site.
15358791 2004 Identifying structural features of fibrillar islet amyloid polypeptide using site-directed spin labeling.
15342243 2004 Atomic force microscopy reveals defects within mica supported lipid bilayers induced by the amyloidogenic human amylin peptide.
15321714 2004 Phospholipid catalysis of diabetic amyloid assembly.
15292167 2004 Amyloidogenicity and cytotoxicity of recombinant mature human islet amyloid polypeptide (rhIAPP).
14659752 2004 The mechanism of insulin action on islet amyloid polypeptide fiber formation.
14656003 2003 Immunohistochemical localization of amylin in human pancreas, thyroid, pituitary and their tumors.
14613923 2004 Extended life span is associated with insulin resistance in a transgenic mouse model of insulinoma secreting human islet amyloid polypeptide.
14578294 2003 Prevalence and clinicopathological characteristics of islet amyloid in chinese patients with type 2 diabetes.
14532296 2003 Fibrillogenic amylin evokes islet beta-cell apoptosis through linked activation of a caspase cascade and JNK1.
12767835 2003 The sequence dependence of fiber organization. A comparative molecular dynamics study of the islet amyloid polypeptide segments 22-27 and 22-29.
12717720 2003 Conformational preferences of the amylin nucleation site in SDS micelles: an NMR study.
12717671 2003 [Nasu Hakola disease: a report of the first two cases in Bolivia].
12706321 2003 S20G mutation of the amylin gene is associated with a lower body mass index in Korean type 2 diabetic patients.
12706318 2003 Apolipoprotein E genotype, islet amyloid deposition and severity of Type 2 diabetes.
12679865 2003 Amylin gene promoter mutations predispose to Type 2 diabetes in New Zealand Maori.
12611974 2003 Human amylin actions on rat cholinergic basal forebrain neurons: antagonism of beta-amyloid effects.
12589759 2003 Full-length rat amylin forms fibrils following substitution of single residues from human amylin.
12588049 2002 Polymorphism in intron 2 of islet amyloid polypeptide gene is associated with lower low-density lipoprotein cholesterol in nondiabetic subjects and in type 2 diabetic patients.
12540610 2003 Increased dietary fat promotes islet amyloid formation and beta-cell secretory dysfunction in a transgenic mouse model of islet amyloid.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12441106 2002 Increased expression and activation of c-Jun contributes to human amylin-induced apoptosis in pancreatic islet beta-cells.
12367525 2002 Identification and characterization of a novel molecular-recognition and self-assembly domain within the islet amyloid polypeptide.
12298020 2002 Inhibition of amyloid fibril formation of human amylin by N-alkylated amino acid and alpha-hydroxy acid residue containing peptides.
12221327 2002 Islet amyloid, metabolic syndrome, and the natural progressive history of type 2 diabetes mellitus.
12086946 2002 Estrogen can prevent or reverse obesity and diabetes in mice expressing human islet amyloid polypeptide.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11318791 2001 The islet amyloid polypeptide (amylin) gene S20G mutation in Chinese subjects: evidence for associations with type 2 diabetes and cholesterol levels.
11246872 2001 The prohormone convertase enzyme 2 (PC2) is essential for processing pro-islet amyloid polypeptide at the NH2-terminal cleavage site.
11145957 2001 Identification of a heparin binding domain in the N-terminal cleavage site of pro-islet amyloid polypeptide. Implications for islet amyloid formation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10931181 2000 Processing of synthetic pro-islet amyloid polypeptide (proIAPP) 'amylin' by recombinant prohormone convertase enzymes, PC2 and PC3, in vitro.
10385705 1999 Multiple amylin receptors arise from receptor activity-modifying protein interaction with the calcitonin receptor gene product.
10342886 1999 An amylin receptor is revealed following co-transfection of a calcitonin receptor with receptor activity modifying proteins-1 or -3.
9794116 1998 Role of S20G mutation of amylin gene in insulin secretion, insulin sensitivity, and type II diabetes mellitus in Taiwanese patients.
9115263 1997 Identification of cis- and trans-active factors regulating human islet amyloid polypeptide gene expression in pancreatic beta-cells.
8845235 1995 Amylin-immunoreactivity is co-stored in a serotonin cell subpopulation of the vertebrate stomach and duodenum.
8772735 1996 Missense mutation of amylin gene (S20G) in Japanese NIDDM patients.
8771910 The effect of different glucose endovenous administrations on amylin and insulin blood concentration in healthy subjects.
8605675 1996 Development of sensitive immunoassays to detect amylin and amylin-like peptides in unextracted plasma.
8557106 1996 Processing of pro-islet amyloid polypeptide (proIAPP) by the prohormone convertase PC2.
8468047 1993 High-resolution chromosomal localization of the human calcitonin/CGRP/IAPP gene family members.
8307253 1993 Chronic overproduction of islet amyloid polypeptide/amylin in transgenic mice: lysosomal localization of human islet amyloid polypeptide and lack of marked hyperglycaemia or hyperinsulinaemia.
8152488 1994 Pancreatic islet cell toxicity of amylin associated with type-2 diabetes mellitus.
7929615 1994 Molecular physiology of amylin.
3535798 1986 A novel peptide in the calcitonin gene related peptide family as an amyloid fibril protein in the endocrine pancreas.
3317417 1987 Purification and characterization of a peptide from amyloid-rich pancreases of type 2 diabetic patients.
3181427 1988 Islet amyloid polypeptide: identification and chromosomal localization of the human gene.
3053705 1988 An islet amyloid peptide is derived from an 89-amino acid precursor by proteolytic processing.
3035556 1987 Amyloid fibrils in human insulinoma and islets of Langerhans of the diabetic cat are derived from a neuropeptide-like protein also present in normal islet cells.
2690069 1989 Molecular and functional characterization of amylin, a peptide associated with type 2 diabetes mellitus.
2666169 1989 Sequence divergence in a specific region of islet amyloid polypeptide (IAPP) explains differences in islet amyloid formation between species.
2651160 1989 The complete islet amyloid polypeptide precursor is encoded by two exons.
2608057 1989 Human islet amyloid polypeptide gene: complete nucleotide sequence, chromosomal localization, and evolutionary history.
2546670 1989 Localisation of islet amyloid peptide in lipofuscin bodies and secretory granules of human B-cells and in islets of type-2 diabetic subjects.
2365085 1990 The human islet amyloid polypeptide (IAPP) gene. Organization, chromosomal localization and functional identification of a promoter region.
2223885 1990 Islet amyloid polypeptide: structure and upstream sequences of the IAPP gene in rat and man.
2189768 1990 Effects of meal ingestion on plasma amylin concentration in NIDDM and nondiabetic humans.
2091067 1990 Isolation and identification of islet amyloid polypeptide in normal human pancreas.
2039456 1991 Solution structures of calcitonin-gene-related-peptide analogues of calcitonin-gene-related peptide and amylin.
1282806 1992 Characterization of the human islet amyloid polypeptide/amylin gene transcripts: identification of a new polyadenylation site.