Property Summary

NCBI Gene PubMed Count 270
PubMed Score 1751.63
PubTator Score 1407.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (231)

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY      1 - 70
GKRNAVEVLKREPLNYLPL                                                        71 - 89
//

Text Mined References (273)

PMID Year Title