Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.0e-43
Disease Target Count Z-score Confidence
Moyamoya disease 10 4.082 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.500 1.0e-43

Gene RIF (1)

AA Sequence

MPPRGPASELLLLRLLLLGAATAAPLAPRPSKEELTRCLAEVVTEVLTVGQVQRGPCTALLHKELCGTEP      1 - 70
HGCASTEEKGLLLGDFKKQEAGKMRSSQEVRDEEEEEVAERTHKSEVQEQAIRMQGHRQLHQEEDEEEEK     71 - 140
EERKRGPMETFEDLWQRHLENGGDLQKRVAEKASDKETAQFQAEEKGVRVLGGDRSLWQGAERGGGERRE    141 - 210
DLPHHHHHHHQPEAEPRQEKEEASEREEKEVEQLEHLRDELKKVTETLGEQLRREG                  211 - 266
//

Text Mined References (4)

PMID Year Title