Property Summary

NCBI Gene PubMed Count 2
PubMed Score 8.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Synonym

Accession I3L273
Symbols Goofy

Gene

GFY

  Ortholog (3)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG

AA Sequence

MKSFSRILFLVFLLAGLRSKAAPSAPLPLGCGFPDMAHPSETSPLKGASENSKRDRLNPEFPGTPYPEPS      1 - 70
KLPHTVSLETFPLDFTEPLNPDLRETPHPESPETPKADSLTTSISESLDMPKTNLSKMAHPESSETPTPG     71 - 140
PTEMPHPGSPETPKPNFSKTSRPEFPETPNTDLMQTTPQESPEILQLNATEVSQAELPETSNTNPTKTPD    141 - 210
PKSPEKHDLNSTETPNSEFLQALHPDPSKTPHPESHVTHNPSPTEISQTEFPTTYYQNATDVPRTSDPQI    211 - 280
STSLYPETPVPFKDDATALNELSLNPKPGTPAAIQPDSPKLPTSDSPGMVELKAPQNSGPKESNVPPPSA    281 - 350
RIAGPPALPGRPSQLAPATLRAPQRHSRGEGVNTIIVVERVKETGVTLVGRPRGAAGGALCLFFAGTALL    351 - 420
IGIFVLLWCLYRRAARQRPFAHHRLPDDGDEPVLHLDAPKDPYDLYFYAPDTWVPSHIATKQPPPTPPLP    421 - 490
PKLPPPPRGGRPQRLEALSPATLPNNFV                                              491 - 518
//

Text Mined References (2)

PMID Year Title
23926254 2013 Goofy coordinates the acuity of olfactory signaling.
15057824 2004 The DNA sequence and biology of human chromosome 19.