Property Summary

NCBI Gene PubMed Count 2
PubMed Score 8.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession I3L273
Symbols Goofy

Gene

GFY

AA Sequence

MKSFSRILFLVFLLAGLRSKAAPSAPLPLGCGFPDMAHPSETSPLKGASENSKRDRLNPEFPGTPYPEPS      1 - 70
KLPHTVSLETFPLDFTEPLNPDLRETPHPESPETPKADSLTTSISESLDMPKTNLSKMAHPESSETPTPG     71 - 140
PTEMPHPGSPETPKPNFSKTSRPEFPETPNTDLMQTTPQESPEILQLNATEVSQAELPETSNTNPTKTPD    141 - 210
PKSPEKHDLNSTETPNSEFLQALHPDPSKTPHPESHVTHNPSPTEISQTEFPTTYYQNATDVPRTSDPQI    211 - 280
STSLYPETPVPFKDDATALNELSLNPKPGTPAAIQPDSPKLPTSDSPGMVELKAPQNSGPKESNVPPPSA    281 - 350
RIAGPPALPGRPSQLAPATLRAPQRHSRGEGVNTIIVVERVKETGVTLVGRPRGAAGGALCLFFAGTALL    351 - 420
IGIFVLLWCLYRRAARQRPFAHHRLPDDGDEPVLHLDAPKDPYDLYFYAPDTWVPSHIATKQPPPTPPLP    421 - 490
PKLPPPPRGGRPQRLEALSPATLPNNFV                                              491 - 518
//

Text Mined References (2)

PMID Year Title
23926254 2013 Goofy coordinates the acuity of olfactory signaling.
15057824 2004 The DNA sequence and biology of human chromosome 19.