Knowledge Summary

Patent

No data available

AA Sequence

MGDDQEDDFPRRLSESMEDLSLDLGALQGSEYLQDLGLGAPSHSQPGETPDSRPTGEEPGRDSLFSSLAG      1 - 70
SQDLSRRRSWERSRSCSESWRRLSLDASAVDEEPCLPRTLASLALNLPGGGLKTWTQGCLSGGGTPAESP     71 - 140
GKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDHVLIVQQVLQEL    141 - 210
RQYHGARQRACMSASPGGAHSNLTWFEFLSESEDGAGKNEKSDKSTSVKRRLSCLRSRVTRQKEKGKSPA    211 - 280
HLKDKGQDARERRECVNGHQLLQGTFSGPSSCPLCGKPFLSSGKSGGPIHPPGGQPLSLLHVLSIILLGS    281 - 350
LLMCASSFCFALSSAAPWREPGISPWAQGPLG                                          351 - 382
//

Text Mined References (3)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19367720 2008 Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.
15057824 2004 The DNA sequence and biology of human chromosome 19.