Knowledge Summary

Patent

No data available

AA Sequence

MGDDQEDDFPRRLSESMEDLSLDLGALQGSEYLQDLGLGAPSHSQPGETPDSRPTGEEPGRDSLFSSLAG      1 - 70
SQDLSRRRSWERSRSCSESWRRLSLDASAVDEEPCLPRTLASLALNLPGGGLKTWTQGCLSGGGTPAESP     71 - 140
GKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPPVQGLEPPVLECMEKDHVEPDHVLIVQQVLQEL    141 - 210
RQYHGARQRACMSASPGGAHSNLTWFEFLSESEDGAGKNEKSDKSTSVKRRLSCLRSRVTRQKEKGKSPA    211 - 280
HLKDKGQDARERRECVNGHQLLQGTFSGPSSCPLCGKPFLSSGKSGGPIHPPGGQPLSLLHVLSIILLGS    281 - 350
LLMCASSFCFALSSAAPWREPGISPWAQGPLG                                          351 - 382
//

Text Mined References (3)

PMID Year Title