Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.500 1.9e-03
atypical teratoid / rhabdoid tumor 1.500 7.1e-04
glioblastoma 1.300 3.5e-03
medulloblastoma, large-cell 2.000 8.0e-06
osteosarcoma 1.697 8.7e-07
ovarian cancer 1.400 2.6e-11

AA Sequence

MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHS      1 - 70
ALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRGLHRRGLGRAEQPERGRAGGP     71 - 140
GAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAEDWETEY                            141 - 186
//

Text Mined References (2)

PMID Year Title