Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.697 0.000
atypical teratoid / rhabdoid tumor 1.500 0.001
glioblastoma 1.300 0.004
medulloblastoma, large-cell 2.000 0.000
adult high grade glioma 1.500 0.002
ovarian cancer 1.400 0.000

Synonym

Accession I3L1E1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MEQPKDGAGPEGNNLSLPSSGTEPWPPAPLPAPPPLLLNSTDPTHLGLPESVASVTVPIRLDTLSCLLHS      1 - 70
ALLGAYTFQQALPSCPCCSQAGHSQPGAVRRPPRGRGGWEVRHRPGWGRGLHRRGLGRAEQPERGRAGGP     71 - 140
GAGPRTPPMTLPSPPTLPAQDGKKEARGPEPPLETPLAAEDWETEY                            141 - 186
//

Text Mined References (2)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.