Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (2)

AA Sequence

MASAITQCSTSELTCSICTDYLTDPVTICCGHRFCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFA      1 - 70
EKQVIPTRESVPCQLSSSAMLICRRHQEIKNLICETDRSLLCFLCSQSPRHATHKHYMTREADEYYRKKL     71 - 140
LIQMKSIWKKKQKNQRNLNRETNIIGTWEVFINLRSMMISAEYPKVCQYLREEEQKHVESLAREGRIIFQ    141 - 210
QLKRSQTRMAKMGILLREMYEKLKEMSCKADVNLPQDLGDVMKRNEFLRLAMPQPVNPQLSAWTITGVSE    211 - 280
RLNFFRVYITLDRKICSNHKLLFEDLRHLQCSLDDTDMSCNPTSTQYTSSWGAQILSSGKHYWEVDVKDS    281 - 350
CNWVIGLCREAWTKRNDMRLDSEGIFLLLCLKVDDHFSLFSTSPLLPHYIPRPQGWLGVFLDYECGIVSF    351 - 420
VNVAQSSLICSFLSRIFYFPLRPFICHGSK                                            421 - 450
//

Text Mined References (2)

PMID Year Title