Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.42
PubTator Score 4.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Huntington's disease 72 4.563 2.3

Gene RIF (6)

PMID Text
25446099 specific interaction of HYPK with HTT-N17 is crucial for the chaperone activity of HYPK
25116620 By virtue of its flexibility and nascent peptide binding activity, HYPK may play an important role in assisting protein (re)folding.
24465598 Chaperone-like protein HYPK is induced by cellular stress and is under transcriptional regulation by HSF1.
24361604 maintenance of HYPK expression by HSF1 is necessary for the survival of cells under thermal stress conditions
23272104 HYPK has roles in regulating cell growth, cell cycle, unfolded protein response and cell death
17947297 The present study, has confirmed, by confocal microscopy and immunoprecipitation, that HYPK interacts with the N-terminal of Htt.

AA Sequence

MRRRGEIDMATEGDVELELETETSGPERPPEKPRKHDSGAADLERVTDYAEEKEIQSSNLETAMSVIGDR      1 - 70
RSREQKAKQEREKELAKVTIKKEDLELIMTEMEISRAAAERSLREHMGNVVEALIALTN                71 - 129
//

Text Mined References (20)

PMID Year Title
25446099 2015 Chaperone protein HYPK interacts with the first 17 amino acid region of Huntingtin and modulates mutant HTT-mediated aggregation and cytotoxicity.
25416956 2014 A proteome-scale map of the human interactome network.
25116620 2014 Conserved C-terminal nascent peptide binding domain of HYPK facilitates its chaperone-like activity.
24465598 2014 Transcription regulation of HYPK by Heat Shock Factor 1.
24361604 2014 Heat shock transcription factor HSF1 regulates the expression of the Huntingtin-interacting protein HYPK.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23272104 2012 Identification of HYPK-interacting proteins reveals involvement of HYPK in regulating cell growth, cell cycle, unfolded protein response and cell death.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20154145 2010 The chaperone-like protein HYPK acts together with NatA in cotranslational N-terminal acetylation and prevention of Huntingtin aggregation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18076027 2008 Huntingtin interacting protein HYPK is intrinsically unstructured.
17947297 2008 HYPK, a Huntingtin interacting protein, reduces aggregates and apoptosis induced by N-terminal Huntingtin with 40 glutamines in Neuro2a cells and exhibits chaperone-like activity.
16950395 2006 hCLE/CGI-99, a human protein that interacts with the influenza virus polymerase, is a mRNA transcription modulator.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9700202 1998 Huntingtin interacts with a family of WW domain proteins.