Property Summary

NCBI Gene PubMed Count 20
PubMed Score 6.87
PubTator Score 4.46

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25854352 The association between AGPHD1 single nucleotide polymorphism rs8034191 and lung cancer risk was significant using multiple genetic models, suggesting that AGPHD1 single nucleotide polymorphism rs8034191 is a risk factor for lung cancer.
25074529 The variant rs8034191 in the AGPHD1 gene may not modify the genetic risk of lung cancer in Asian populations.
22701590 AGPHD1 gene rs8034191-T allele might be a risk-conferring factor for the development of lung cancer in Caucasians, but not in East-Asians.
21810735 Women with the variant AA genotype of CHRNA5 rs16969968 or variant CC genotype of LOC123688 rs8034191 were at significantly increased risk of heavy smoking.
21081471 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20587604 Observational study of gene-disease association. (HuGE Navigator)
20554942 Observational study of gene-disease association. (HuGE Navigator)
20548021 Meta-analysis of gene-disease association. (HuGE Navigator)
19733931 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPTEYVLKISNTK      1 - 70
ASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKSYLVRLLTYLPGRPIAELPVS     71 - 140
PQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKNVPLLEKYLYALGQNRNREIVEHVIHLFKEE    141 - 210
VMTKLSHFRECINHGDLNDHNILIESSKSASGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSP    211 - 280
IQVGGHVLAGFESITPLTAVEKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFD    281 - 350
MGQKAVEEIWFETAKSYESGISM                                                   351 - 373
//

Text Mined References (23)

PMID Year Title
25854352 2015 Meta-analysis of the association between the rs8034191 polymorphism in AGPHD1 and lung cancer risk.
25074529 2014 Genetic association between AGPHD1 variant and lung cancer risk.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
22701590 2012 Strong association between two polymorphisms on 15q25.1 and lung cancer risk: a meta-analysis.
22241472 2012 Molecular identification of hydroxylysine kinase and of ammoniophospholyases acting on 5-phosphohydroxy-L-lysine and phosphoethanolamine.
21810735 2011 Single nucleotide polymorphisms in CHRNA5 rs16969968, CHRNA3 rs578776, and LOC123688 rs8034191 are associated with heaviness of smoking in women in Northeastern Ontario, Canada.
21685187 2011 Genome-wide association study of smoking behaviours in patients with COPD.
21081471 2011 Genetic variations on chromosomes 5p15 and 15q25 and bladder cancer risk: findings from the Los Angeles-Shanghai bladder case-control study.
20587604 2010 Fine mapping of chromosome 15q25.1 lung cancer susceptibility in African-Americans.
20554942 2010 Nicotinic acetylcholine receptor region on chromosome 15q25 and lung cancer risk among African Americans: a case-control study.
20548021 2010 Replication of lung cancer susceptibility loci at chromosomes 15q25, 5p15, and 6p21: a pooled analysis from the International Lung Cancer Consortium.
19733931 2010 Blood-based CHRNA3 single nucleotide polymorphism and outcome in advanced non-small-cell lung cancer patients.
19654303 2009 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.
19300482 2009 A genome-wide association study in chronic obstructive pulmonary disease (COPD): identification of two major susceptibility loci.
18780872 2008 Familial aggregation of common sequence variants on 15q24-25.1 in lung cancer.
18385738 2008 A susceptibility locus for lung cancer maps to nicotinic acetylcholine receptor subunit genes on 15q25.
18385676 2008 Genome-wide association scan of tag SNPs identifies a susceptibility locus for lung cancer at 15q25.1.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.