Property Summary

NCBI Gene PubMed Count 53
PubMed Score 102.54
PubTator Score 75.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
nephrosclerosis 1.053 8.8e-04
psoriasis 1.200 8.2e-04
non-small cell lung cancer -1.270 4.3e-20
intraductal papillary-mucinous neoplasm ... -1.100 3.7e-03
lung adenocarcinoma -2.200 4.2e-26

Protein-protein Interaction (5)

Gene RIF (26)

PMID Text
26453961 Data show that DNA methylation at CpG island of hyaluronoglucosaminidase 2 (HYLA2) could be used to identify stage II and III colon cancer patients who are most likely to benefit from 5-flourouracil chemotherapy with respect to progression-free survival.
26112095 High expression of S100P and HYAL2 is significantly associated with advanced disease and shorter survival of triple-negative breast cancer and S100P and HYAL2 could be potential prognostic markers of TNBC.
25864644 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25411425 Lower platelet HYAL2 levels and activity are associated with inflammatory bowel disease.
25232017 HYAL2 plays a redundant role in the catalysis of megadalton HA to its 20 kDa intermediate during fertilization.
25213452 A strong association between decreased HYAL2 methylation in peripheral blood and BC.
23560496 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
21743962 HAS2-HYAL2/CD44 system may support spontaneous chemokinesis of human cancer cells through self-degradation of HMW-HA to produce LMW-HA by an autocrine mechanism.
20875124 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma
20864512 Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator)
20849597 Overexpression of HYAL2 is associated with colorectal cancer.
20554532 ROS induce Hyal2, suggesting that Hyal2 is likely responsible for the sustained HA fragmentation in the airway lumen observed in inflammatory conditions associated with oxidative stress.
20072653 Data show that a significant in expression levels of HA synthases (HASs) and hyaluronidases (Hyals) was observed in vitro on stimulation of epithelial ovarian carcinoma cells by gonadotropins.
19443707 platelets and megakaryocytes contain only hyaluronidase 2 (HYAL2) but not HYAL1
19435493 HYAL1, but not HYAL2, expression is reduced and correlates with the accumulation of hyaluronan in ovarian carcinomas.
19140316 Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer
19081476 alternative splicing variants, M-RIP, HYAL2, CDCA1, and MSMB genes showed differential expressions between cancer cells and corresponding normal tissues.
17229709 purified human Hyal2 is a weak acid-active hyaluronidase
16837837 Association of hyaluronidases 1/2 expresion with neurons in the infarcted and peri-infarcted regions of the middle cerebral artery.
15923194 In chondrocytes, HYAL-2 appears to be constitutively expressed and not inducibly regulated by catabolic agents. As such, it appears that the expression of lysosomal hyaluronidase participates little in the overall regulation of hyaluronan catabolism.
15596803 soluble active form expressed and characterized as Jaagsiekte sheep retrovirus receptor
12684632 Down-regulation of HYAL2 is associated with small cell lung cancer and glioma
12676986 Hyaluronidase 2 negatively regulates RON receptor tyrosine kinase and mediates transformation of epithelial cells by jaagsiekte sheep retrovirus.
12584308 suppresses transformation by the Env proteins of jaagsiekte sheep retrovirus and enzootic nasal tumor virus in rodent fibroblasts by increasing Env degradation
12174938 more elevated in human brain metastases than in primary brain tumours
9933825 Similar in structure to hyaluronidases, which intracellularly degrade hyaluronan. The accumulation of hyaluronan (HA) in the renal cortex is a characteristic feature of inflammatory renal diseases and could participate in immune renal injury.

AA Sequence

MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAFDVQASPNEGF      1 - 70
VNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHYIRTQESAGLAVIDWEDWRPV     71 - 140
WVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFEFAAQQFMLETLRYVKAVRPRHLWGFYLFPD    141 - 210
CYNHDYVQNWESYTGRCPDVEVARNDQLAWLWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVAR    211 - 280
THHANHALPVYVFTRPTYSRRLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRL    281 - 350
LVPYVVNVSWATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH    351 - 420
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL                     421 - 473
//

Text Mined References (53)

PMID Year Title
26453961 2015 Methylation status at HYAL2 predicts overall and progression-free survival of colon cancer patients under 5-FU chemotherapy.
26112095 2015 S100P and HYAL2 as prognostic markers for patients with triple-negative breast cancer.
25864644 2015 CD44 knock-down in bovine and human chondrocytes results in release of bound HYAL2.
25416956 2014 A proteome-scale map of the human interactome network.
25411425 2015 Platelet hyaluronidase-2: an enzyme that translocates to the surface upon activation to function in extracellular matrix degradation.
25232017 2014 Hyaluronidase 2: a novel germ cell hyaluronidase with epididymal expression and functional roles in mammalian sperm.
25213452 2015 DNA methylation array analyses identified breast cancer-associated HYAL2 methylation in peripheral blood.
23560496 2013 Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma.
21743962 2011 Fragmented hyaluronan is an autocrine chemokinetic motility factor supported by the HAS2-HYAL2/CD44 system on the plasma membrane.
21740893 2011 Hyal2 is a glycosylphosphatidylinositol-anchored, lipid raft-associated hyaluronidase.
21699545 Ultraviolet-B irradiation induces differential regulations of hyaluronidase expression and activity in normal human keratinocytes.
20875124 2010 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma.
20864512 2010 A panel of sputum-based genomic marker for early detection of lung cancer.
20849597 2010 Involvement of hyaluronidases in colorectal cancer.
20554532 2010 Reactive oxygen species and hyaluronidase 2 regulate airway epithelial hyaluronan fragmentation.
20072653 2010 Peritoneal adhesion and angiogenesis in ovarian carcinoma are inversely regulated by hyaluronan: the role of gonadotropins.
19577615 2009 bFGF induces changes in hyaluronan synthase and hyaluronidase isoform expression and modulates the migration capacity of fibrosarcoma cells.
19443707 2009 Platelet-derived hyaluronidase 2 cleaves hyaluronan into fragments that trigger monocyte-mediated production of proinflammatory cytokines.
19435493 2009 Expression of hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in serous ovarian carcinomas: inverse correlation between HYAL1 and hyaluronan content.
19366691 2009 Transforming growth factor beta1 signaling via interaction with cell surface Hyal-2 and recruitment of WWOX/WOX1.
19140316 [Down-regulation of RBSP3/CTDSPL, NPRL2/G21, RASSF1A, ITGA9, HYAL1 and HYAL2 genes in non-small cell lung cancer].
19081476 2009 Cancer-associated splicing variants of the CDCA1 and MSMB genes expressed in cancer cell lines and surgically resected gastric cancer tissues.
18725949 2008 HYAL1 and HYAL2 inhibit tumour growth in vivo but not in vitro.
18390475 2008 Hyaluronidase expression and activity is regulated by pro-inflammatory cytokines in human airway epithelial cells.
17229709 2007 Ability of hyaluronidase 2 to degrade extracellular hyaluronan is not required for its function as a receptor for jaagsiekte sheep retrovirus.
17170110 2007 CD44-dependent intracellular and extracellular catabolism of hyaluronic acid by hyaluronidase-1 and -2.
16990026 2006 Hyal2, where are you?
16837837 2006 Hyaluronan expression following middle cerebral artery occlusion in the rat.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16600643 2006 Expression and cellular localization of human hyaluronidase-2 in articular chondrocytes and cultured cell lines.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16191204 2005 Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus.
15923194 2005 Characterization of promoter elements of the human HYAL-2 gene.
15596803 2005 Expression and characterization of a soluble, active form of the jaagsiekte sheep retrovirus receptor, Hyal2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12684632 Expression and regulation patterns of hyaluronidases in small cell lung cancer and glioma lines.
12676986 2003 Hyaluronidase 2 negatively regulates RON receptor tyrosine kinase and mediates transformation of epithelial cells by jaagsiekte sheep retrovirus.
12584308 2003 Role of virus receptor Hyal2 in oncogenic transformation of rodent fibroblasts by sheep betaretrovirus env proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12174938 Hyaluronidase is more elevated in human brain metastases than in primary brain tumours.
11944887 2002 Hyaluronidases and CD44 undergo differential modulation during chondrogenesis.
11731268 2001 Hyal2--less active, but more versatile?
11296287 2001 Candidate tumor suppressor HYAL2 is a glycosylphosphatidylinositol (GPI)-anchored cell-surface receptor for jaagsiekte sheep retrovirus, the envelope protein of which mediates oncogenic transformation.
11085536 2000 The 630-kb lung cancer homozygous deletion region on human chromosome 3p21.3: identification and evaluation of the resident candidate tumor suppressor genes. The International Lung Cancer Chromosome 3p21.3 Tumor Suppressor Gene Consortium.
10989127 2000 Human hyaluronidases: electrophoretic multiple forms in somatic tissues and body fluids. Evidence for conserved hyaluronidase potential N-glycosylation sites in different mammalian species.
9933825 1998 Expression profile of hyaluronidase mRNA transcripts in the kidney and in renal cells.
9790770 1998 Structural organization and chromosomal localization of Hyal2, a gene encoding a lysosomal hyaluronidase.
9712871 1998 HYAL2, a human gene expressed in many cells, encodes a lysosomal hyaluronidase with a novel type of specificity.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8603390 1996 Construction of a 600-kilobase cosmid clone contig and generation of a transcriptional map surrounding the lung cancer tumor suppressor gene (TSG) locus on human chromosome 3p21.3: progress toward the isolation of a lung cancer TSG.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.