Property Summary

NCBI Gene PubMed Count 63
PubMed Score 78.64
PubTator Score 83.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count
Hyaluronidase Deficiency 1
Disease Target Count P-value
lung adenocarcinoma 2714 4.58117116286568E-13
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 24 3.959 2.0
Disease Target Count Z-score Confidence
Cancer 2346 3.282 1.6
Disease Target Count
mucopolysaccharidosis IX 2
Disease Target Count
Mucopolysaccharidosis 9 1

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.700 0.000

Synonym

Accession Q12794 Q6FH23 Q6PIZ6 Q7KYU2 Q7LE34 Q8NFK5 Q8NFK6 Q8NFK7 Q8NFK8 Q8NFK9 Q93013 Q9UKD5 Q9UNI8 Hyal-1
Symbols MPS9
NAT6
LUCA1
HYAL-1

Gene

PANTHER Protein Class (2)

PDB

2PE4  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG

Gene RIF (37)

PMID Text
26138586 The receiver-operating characteristic curve analyses demonstrated that each one had good sensitivity and specificity for distinguishing BC patients from non-BC ones (HYAL1, miR-210, miR-96, lncRNA-UCA1, 91.5 and ).
25584766 Study showed that reduced HYAL1 expression was associated with endometrial carcinoma aggressiveness, which further supported the role of hyaluronan degradation in cancer progression.
24820161 Results demonstrated that HYAL1 was C-mannosylated and suggest the possible role of C-mannosylation for secretion and enzymatic activity of HYAL1.
23166824 Hyaluronan (HA) interacting proteins RHAMM and hyaluronidase impact prostate cancer cell behavior and invadopodia formation in 3D HA-based hydrogels.
21829529 Upregulation of HYAL1 expression in breast cancer promoted tumor cell proliferation, migration, invasion and angiogenesis.
21695196 This is the first report showing high HYAL-1 levels in epithelial ovarian cancer.
21559944 In contrast to the previously described MPS IX patient, our three patients display a phenotype limited to the joints, suggesting that this is the primary manifestation of HYAL1 deficiency.
20960509 HYAL-1 and HAS1 expression predicted BCa metastasis, and HYAL-1 expression also predicted disease-specific survival.
20875124 Hyaluronan synthases (HAS1-3) and hyaluronidases (HYAL1-2) in the accumulation of hyaluronan in endometrioid endometrial carcinoma
20849597 Overexpression of HYAL1 is associated with colorectal cancer.
More...

AA Sequence

MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPD      1 - 70
MTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFN     71 - 140
WDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNY    141 - 210
DFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPN    211 - 280
LPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILN    281 - 350
VTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC    351 - 420
YPGWQAPWCERKSMW                                                           421 - 435
//

Text Mined References (63)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26138586 2015 Integrative functional genetic-epigenetic approach for selecting genes as urine biomarkers for bladder cancer diagnosis.
25584766 2015 Decreased hyaluronidase 1 expression is associated with early disease recurrence in human endometrial cancer.
24820161 2014 C-mannosylation of human hyaluronidase 1: possible roles for secretion and enzymatic activity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23166824 2012 Hyaluronan (HA) interacting proteins RHAMM and hyaluronidase impact prostate cancer cell behavior and invadopodia formation in 3D HA-based hydrogels.
21829529 2011 Upregulation of HYAL1 expression in breast cancer promoted tumor cell proliferation, migration, invasion and angiogenesis.
21699545 Ultraviolet-B irradiation induces differential regulations of hyaluronidase expression and activity in normal human keratinocytes.
21695196 2011 Subtype specific elevated expression of hyaluronidase-1 (HYAL-1) in epithelial ovarian cancer.
More...