Property Summary

NCBI Gene PubMed Count 41
PubMed Score 446.69
PubTator Score 228.48

Knowledge Summary

Patent (12,881)

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 1.1e-03
primary Sjogren syndrome 788 8.9e-03
Disease Target Count Z-score Confidence
Herpes simplex 19 3.507 1.8
Retinitis 9 3.229 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.208 1.1e-03
primary Sjogren syndrome 1.200 8.9e-03

Gene RIF (32)

PMID Text
26559003 Our data demonstrated that the expression of Hv1 in pancreatic islet beta-cells regulates insulin secretion through regulating Ca(2+) homeostasis.
26458876 Trp207 is crucial for slow channel opening, highly temperature-dependent gating kinetics, proton selectivity, and DeltapH-dependent gating.
25964989 The main properties of the voltage-gated proton channel (HV1) are described in this review, along with what is known about how the channel protein structure accomplishes its functions. [review]
25446125 analysis of of the C-terminal domain of voltage-gated proton channel HV1 and the thermodynamic characteristics of Zn(2) binding to this domain
25425665 A shorter isoform of HVCN1 with enhanced gating is specifically enriched in malignant B cells.
25296308 Hv1 activity displays hysteresis
24867409 Divalent metal binding causes a conformational change in human the Hv1 c-terminal domain.
24379371 Salt bridge networks and the hydrophobic plug function as the gate in Hv1 channels; outward movement of the fourth transmembrane segment leads to the opening of this gate.
23940591 Results suggest that Hv1 may be used as a potential biomarker for diagnosis and prognosis of colorectal carcinoma, and a potential target for anticancer drugs in colorectal cancer therapy.
23891691 inhibition of Hv1 activity via Zn(2+) ions can effectively retard the cancer growth and suppress the cancer metastasis by the decrease of proton extrusion and the down-regulation of gelatinase activity
23352165 Two conformational changes are detected in Hv1 channels that are involved in channel opening.
23352164 In the Hv1 voltage-gated channel a highly conserved phenylalanine is found in the charge transfer center.
22388960 Hv1-dependent reactive oxygen species production is responsible for a substantial fraction of brain damage at early time points after ischemic stroke.
22367212 inhibition of Hv1 function via knockdown of Hv1 expression can effectively retard cancer growth
22056415 Hv1 channels maintain a physiological membrane potential during the respiratory burst of neutrophils by providing a compensating charge for the electrons transferred by NOX2 from NADPH to superoxide.
22020278 identification of aspartate 112 as a crucial component of the selectivity filter of H(V)1
21843503 Interactions with two of the S4 arginines and the formation of a well defined hydrophobic gap in the center of the Hv1 are key to the formation of a robust water wire.
21821008 these results strongly suggest that Hv1 regulates breast cancer intracellular pH and exacerbates the migratory ability of metastatic cells.
21124855 Data demonstrated that a massive reduction in H(v)1 expression can limit the Nox2 mediated superoxide production of PLB-985 granulocytes.
20961760 HVCN1 not only modulates signaling from the B-cell receptor following B-cell activation and histamine release from basophils, but also mediates pH-dependent activation of spermatozoa, as well as acid secretion by tracheal epithelium. [Review]
20676047 Report on the interaction of HV1 proton channel protomers during ion channel gating.
20548053 The HVCN1 H(+) channel mediates pH-regulated acid secretion by the airway epithelium. Apical HVCN1 represents a mechanism to acidify an alkaline airway surface liquid.
20543828 Molecular dynamics simulations revealed water molecules in the central crevice of Hv1 model structures but not in homologous voltage-sensor domain (VSD) structures.
20147290 In the 2.0 A structure of the C-terminal domain, the two monomers form a dimer via a parallel alpha-helical coiled-coil, in which one chloride ion binds with the Neta atom of Arg(264).
20144758 Since Hv1 specifically mediates proton efflux, it is likely to be the long-sought molecule that controls male fertility by mediating intracellular alkalinization of human sperm
20037153 Identification of Thr29 as a critical phosphorylation site that activates the human proton channel Hvcn1 in leukocytes
20018719 Hv1 channels truncated just downstream of R2 in the S4 segment retain most channel properties.
19255483 The C-terminal domain of the human voltage-gated proton channel Hv1 (C-Hv1) was overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method.
19233200 The Hv1 channel voltage sensor domain by itself supports H(+) flux.
18509058 Hv1 forms a dimer in the membrane;its regions that are close to the dimer interface were defined.
17948262 We cloned a new B cell-specific tetraspanning (BTS) membrane molecule
16554753 data presented here identify H(v)1 as a long-sought voltage-gated H+ channel and establish H(v)1 as the founding member of a family of mammalian VSD proteins

AA Sequence

MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA      1 - 70
APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH     71 - 140
YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA    141 - 210
RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN           211 - 273
//

Text Mined References (44)

PMID Year Title
26559003 2015 The voltage-gated proton channel Hv1 is expressed in pancreatic islet ?-cells and regulates insulin secretion.
26458876 2015 Tryptophan 207 is crucial to the unique properties of the human voltage-gated proton channel, hHV1.
25964989 2015 The Voltage-Gated Proton Channel: A Riddle, Wrapped in a Mystery, inside an Enigma.
25446125 2015 The pH-sensitive structure of the C-terminal domain of voltage-gated proton channel and the thermodynamic characteristics of Zn²? binding to this domain.
25425665 2014 Enhanced activation of an amino-terminally truncated isoform of the voltage-gated proton channel HVCN1 enriched in malignant B cells.
25296308 2014 Hv1 proton channel opening is preceded by a voltage-independent transition.
24867409 2014 Interaction of divalent metal ions with the carboxyl-terminal domain of human voltage-gated proton channel Hv1.
24379371 2014 Hydrophobic plug functions as a gate in voltage-gated proton channels.
23940591 2013 Human voltage-gated proton channel hv1: a new potential biomarker for diagnosis and prognosis of colorectal cancer.
23891691 2013 Zn(2+) induces apoptosis in human highly metastatic SHG-44 glioma cells, through inhibiting activity of the voltage-gated proton channel Hv1.
23352165 2013 Subunit interactions during cooperative opening of voltage-gated proton channels.
23352164 2013 Voltage-sensing domain of voltage-gated proton channel Hv1 shares mechanism of block with pore domains.
22388960 2012 The voltage-gated proton channel Hv1 enhances brain damage from ischemic stroke.
22367212 2012 Clinicopathological and biological significance of human voltage-gated proton channel Hv1 protein overexpression in breast cancer.
22056415 2012 Do Hv1 proton channels regulate the ionic and redox homeostasis of phagosomes?
22020278 2011 Aspartate?112 is the selectivity filter of the human voltage-gated proton channel.
21843503 2012 Water wires in atomistic models of the Hv1 proton channel.
21821008 2011 Specific expression of the human voltage-gated proton channel Hv1 in highly metastatic breast cancer cells, promotes tumor progression and metastasis.
21124855 2010 Molecular and functional characterization of Hv1 proton channel in human granulocytes.
20961760 2011 pH regulation and beyond: unanticipated functions for the voltage-gated proton channel, HVCN1.
20693294 2010 Physiological roles of voltage-gated proton channels in leukocytes.
20676047 Oligomerization of the voltage-gated proton channel.
20548053 2010 Function of the HVCN1 proton channel in airway epithelia and a naturally occurring mutation, M91T.
20543828 2010 An aqueous H+ permeation pathway in the voltage-gated proton channel Hv1.
20147290 2010 The role and structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1.
20144758 2010 Acid extrusion from human spermatozoa is mediated by flagellar voltage-gated proton channel.
20139987 2010 HVCN1 modulates BCR signal strength via regulation of BCR-dependent generation of reactive oxygen species.
20037153 2010 Identification of Thr29 as a critical phosphorylation site that activates the human proton channel Hvcn1 in leukocytes.
20018719 2010 Functionality of the voltage-gated proton channel truncated in S4.
19805063 2009 Voltage-gated proton channels maintain pH in human neutrophils during phagocytosis.
19255483 2009 Expression, purification, crystallization and preliminary crystallographic study of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1.
19233200 2009 Functional reconstitution of purified human Hv1 H+ channels.
18509058 2008 Dimeric subunit stoichiometry of the human voltage-dependent proton channel Hv1.
18356202 2008 Detailed comparison of expressed and native voltage-gated proton channel currents.
17948262 2007 Cloning of B cell-specific membrane tetraspanning molecule BTS possessing B cell proliferation-inhibitory function.
16556803 2006 A voltage sensor-domain protein is a voltage-gated proton channel.
16554753 2006 A voltage-gated proton-selective channel lacking the pore domain.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.