| Tbio | Voltage-gated hydrogen channel 1 |
Mediates the voltage-dependent proton permeability of excitable membranes. Forms a proton-selective channel through which protons may pass in accordance with their electrochemical gradient. Proton efflux, accompanied by membrane depolarization, facilitates acute production of reactive oxygen species in phagocytosis.
This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
This gene encodes a voltage-gated protein channel protein expressed more highly in certain cells of the immune system. Phagocytic cells produce superoxide anions which require this channel protein, and in B cells this same process facilitates antibody production. This same channel protein, however, can also regulate functions in other cells including spermatozoa. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| osteosarcoma | 7933 | 1.1e-03 |
| primary Sjogren syndrome | 788 | 8.9e-03 |
| Disease | log2 FC | p |
|---|---|---|
| osteosarcoma | -1.208 | 1.1e-03 |
| primary Sjogren syndrome | 1.200 | 8.9e-03 |
| PMID | Text | |
|---|---|---|
| 26559003 | Our data demonstrated that the expression of Hv1 in pancreatic islet beta-cells regulates insulin secretion through regulating Ca(2+) homeostasis. | |
| 26458876 | Trp207 is crucial for slow channel opening, highly temperature-dependent gating kinetics, proton selectivity, and DeltapH-dependent gating. | |
| 25964989 | The main properties of the voltage-gated proton channel (HV1) are described in this review, along with what is known about how the channel protein structure accomplishes its functions. [review] | |
| 25446125 | analysis of of the C-terminal domain of voltage-gated proton channel HV1 and the thermodynamic characteristics of Zn(2) binding to this domain | |
| 25425665 | A shorter isoform of HVCN1 with enhanced gating is specifically enriched in malignant B cells. | |
| 25296308 | Hv1 activity displays hysteresis | |
| 24867409 | Divalent metal binding causes a conformational change in human the Hv1 c-terminal domain. | |
| 24379371 | Salt bridge networks and the hydrophobic plug function as the gate in Hv1 channels; outward movement of the fourth transmembrane segment leads to the opening of this gate. | |
| 23940591 | Results suggest that Hv1 may be used as a potential biomarker for diagnosis and prognosis of colorectal carcinoma, and a potential target for anticancer drugs in colorectal cancer therapy. | |
| 23891691 | inhibition of Hv1 activity via Zn(2+) ions can effectively retard the cancer growth and suppress the cancer metastasis by the decrease of proton extrusion and the down-regulation of gelatinase activity | |
| 23352165 | Two conformational changes are detected in Hv1 channels that are involved in channel opening. | |
| 23352164 | In the Hv1 voltage-gated channel a highly conserved phenylalanine is found in the charge transfer center. | |
| 22388960 | Hv1-dependent reactive oxygen species production is responsible for a substantial fraction of brain damage at early time points after ischemic stroke. | |
| 22367212 | inhibition of Hv1 function via knockdown of Hv1 expression can effectively retard cancer growth | |
| 22056415 | Hv1 channels maintain a physiological membrane potential during the respiratory burst of neutrophils by providing a compensating charge for the electrons transferred by NOX2 from NADPH to superoxide. | |
| 22020278 | identification of aspartate 112 as a crucial component of the selectivity filter of H(V)1 | |
| 21843503 | Interactions with two of the S4 arginines and the formation of a well defined hydrophobic gap in the center of the Hv1 are key to the formation of a robust water wire. | |
| 21821008 | these results strongly suggest that Hv1 regulates breast cancer intracellular pH and exacerbates the migratory ability of metastatic cells. | |
| 21124855 | Data demonstrated that a massive reduction in H(v)1 expression can limit the Nox2 mediated superoxide production of PLB-985 granulocytes. | |
| 20961760 | HVCN1 not only modulates signaling from the B-cell receptor following B-cell activation and histamine release from basophils, but also mediates pH-dependent activation of spermatozoa, as well as acid secretion by tracheal epithelium. [Review] | |
| 20676047 | Report on the interaction of HV1 proton channel protomers during ion channel gating. | |
| 20548053 | The HVCN1 H(+) channel mediates pH-regulated acid secretion by the airway epithelium. Apical HVCN1 represents a mechanism to acidify an alkaline airway surface liquid. | |
| 20543828 | Molecular dynamics simulations revealed water molecules in the central crevice of Hv1 model structures but not in homologous voltage-sensor domain (VSD) structures. | |
| 20147290 | In the 2.0 A structure of the C-terminal domain, the two monomers form a dimer via a parallel alpha-helical coiled-coil, in which one chloride ion binds with the Neta atom of Arg(264). | |
| 20144758 | Since Hv1 specifically mediates proton efflux, it is likely to be the long-sought molecule that controls male fertility by mediating intracellular alkalinization of human sperm | |
| 20037153 | Identification of Thr29 as a critical phosphorylation site that activates the human proton channel Hvcn1 in leukocytes | |
| 20018719 | Hv1 channels truncated just downstream of R2 in the S4 segment retain most channel properties. | |
| 19255483 | The C-terminal domain of the human voltage-gated proton channel Hv1 (C-Hv1) was overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method. | |
| 19233200 | The Hv1 channel voltage sensor domain by itself supports H(+) flux. | |
| 18509058 | Hv1 forms a dimer in the membrane;its regions that are close to the dimer interface were defined. | |
| 17948262 | We cloned a new B cell-specific tetraspanning (BTS) membrane molecule | |
| 16554753 | data presented here identify H(v)1 as a long-sought voltage-gated H+ channel and establish H(v)1 as the founding member of a family of mammalian VSD proteins |
MATWDEKAVTRRAKVAPAERMSKFLRHFTVVGDDYHAWNINYKKWENEEEEEEEEQPPPTPVSGEEGRAA 1 - 70 APDVAPAPGPAPRAPLDFRGMLRKLFSSHRFQVIIICLVVLDALLVLAELILDLKIIQPDKNNYAAMVFH 71 - 140 YMSITILVFFMMEIIFKLFVFRLEFFHHKFEILDAVVVVVSFILDIVLLFQEHQFEALGLLILLRLWRVA 141 - 210 RIINGIIISVKTRSERQLLRLKQMNVQLAAKIQHLEFSCSEKEQEIERLNKLLRQHGLLGEVN 211 - 273 //
| PMID | Year | Title | |
|---|---|---|---|
| 26559003 | 2015 | The voltage-gated proton channel Hv1 is expressed in pancreatic islet ?-cells and regulates insulin secretion. | |
| 26458876 | 2015 | Tryptophan 207 is crucial to the unique properties of the human voltage-gated proton channel, hHV1. | |
| 25964989 | 2015 | The Voltage-Gated Proton Channel: A Riddle, Wrapped in a Mystery, inside an Enigma. | |
| 25446125 | 2015 | The pH-sensitive structure of the C-terminal domain of voltage-gated proton channel and the thermodynamic characteristics of Zn²? binding to this domain. | |
| 25425665 | 2014 | Enhanced activation of an amino-terminally truncated isoform of the voltage-gated proton channel HVCN1 enriched in malignant B cells. | |
| 25296308 | 2014 | Hv1 proton channel opening is preceded by a voltage-independent transition. | |
| 24867409 | 2014 | Interaction of divalent metal ions with the carboxyl-terminal domain of human voltage-gated proton channel Hv1. | |
| 24379371 | 2014 | Hydrophobic plug functions as a gate in voltage-gated proton channels. | |
| 23940591 | 2013 | Human voltage-gated proton channel hv1: a new potential biomarker for diagnosis and prognosis of colorectal cancer. | |
| 23891691 | 2013 | Zn(2+) induces apoptosis in human highly metastatic SHG-44 glioma cells, through inhibiting activity of the voltage-gated proton channel Hv1. | |
| 23352165 | 2013 | Subunit interactions during cooperative opening of voltage-gated proton channels. | |
| 23352164 | 2013 | Voltage-sensing domain of voltage-gated proton channel Hv1 shares mechanism of block with pore domains. | |
| 22388960 | 2012 | The voltage-gated proton channel Hv1 enhances brain damage from ischemic stroke. | |
| 22367212 | 2012 | Clinicopathological and biological significance of human voltage-gated proton channel Hv1 protein overexpression in breast cancer. | |
| 22056415 | 2012 | Do Hv1 proton channels regulate the ionic and redox homeostasis of phagosomes? | |
| 22020278 | 2011 | Aspartate?112 is the selectivity filter of the human voltage-gated proton channel. | |
| 21843503 | 2012 | Water wires in atomistic models of the Hv1 proton channel. | |
| 21821008 | 2011 | Specific expression of the human voltage-gated proton channel Hv1 in highly metastatic breast cancer cells, promotes tumor progression and metastasis. | |
| 21124855 | 2010 | Molecular and functional characterization of Hv1 proton channel in human granulocytes. | |
| 20961760 | 2011 | pH regulation and beyond: unanticipated functions for the voltage-gated proton channel, HVCN1. | |
| 20693294 | 2010 | Physiological roles of voltage-gated proton channels in leukocytes. | |
| 20676047 | Oligomerization of the voltage-gated proton channel. | ||
| 20548053 | 2010 | Function of the HVCN1 proton channel in airway epithelia and a naturally occurring mutation, M91T. | |
| 20543828 | 2010 | An aqueous H+ permeation pathway in the voltage-gated proton channel Hv1. | |
| 20147290 | 2010 | The role and structure of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1. | |
| 20144758 | 2010 | Acid extrusion from human spermatozoa is mediated by flagellar voltage-gated proton channel. | |
| 20139987 | 2010 | HVCN1 modulates BCR signal strength via regulation of BCR-dependent generation of reactive oxygen species. | |
| 20037153 | 2010 | Identification of Thr29 as a critical phosphorylation site that activates the human proton channel Hvcn1 in leukocytes. | |
| 20018719 | 2010 | Functionality of the voltage-gated proton channel truncated in S4. | |
| 19805063 | 2009 | Voltage-gated proton channels maintain pH in human neutrophils during phagocytosis. | |
| 19255483 | 2009 | Expression, purification, crystallization and preliminary crystallographic study of the carboxyl-terminal domain of the human voltage-gated proton channel Hv1. | |
| 19233200 | 2009 | Functional reconstitution of purified human Hv1 H+ channels. | |
| 18509058 | 2008 | Dimeric subunit stoichiometry of the human voltage-dependent proton channel Hv1. | |
| 18356202 | 2008 | Detailed comparison of expressed and native voltage-gated proton channel currents. | |
| 17948262 | 2007 | Cloning of B cell-specific membrane tetraspanning molecule BTS possessing B cell proliferation-inhibitory function. | |
| 16556803 | 2006 | A voltage sensor-domain protein is a voltage-gated proton channel. | |
| 16554753 | 2006 | A voltage-gated proton-selective channel lacking the pore domain. | |
| 16541075 | 2006 | The finished DNA sequence of human chromosome 12. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15342556 | 2004 | Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12975309 | 2003 | The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
