Property Summary

NCBI Gene PubMed Count 59
PubMed Score 66.44
PubTator Score 33.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Peripheral Neuropathy 303
Disease Target Count P-value
ovarian cancer 8491 5.7e-04
osteosarcoma 7933 1.2e-03
glioblastoma 5572 4.9e-03
non primary Sjogren syndrome sicca 840 3.2e-02
Disease Target Count Z-score Confidence
Liver Cirrhosis 101 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.154 1.2e-03
glioblastoma 1.100 4.9e-03
non primary Sjogren syndrome sicca -1.200 3.2e-02
ovarian cancer 1.100 5.7e-04

Gene RIF (36)

PMID Text
26600172 These results suggest that p21(Waf1/CIP1) and Hus1 play crucial roles in the generation and transmission of bystander damage signals after low-dose alpha-particle irradiation.
26377631 adenine glycosylase activity, mismatch recognition properties and interaction with protein partners of MUTYH and 5 MAP variants were examined; P502L and R520Q had reduced affinity for PCNA; only Q324H was found to have reduced affinity for Hus1
26088138 Intramolecular binding of the rad9 C-terminus in the checkpoint clamp Rad9-Hus1-Rad1 is closely linked with its DNA binding.
25911100 these pockets were not required for 9-1-1 chromatin localization or ATR-mediated CHK1 activation but were necessary for interactions between HUS1 and its binding partner MYH
24062075 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
22926736 HUS1 polymorphisms act as risk breast cancer modifiers in the group of non-carriers of BRCA1/2 mutations.
22586102 Data show models for the ternary PCNA/FEN1/DNA and Rad9-Rad1-Hus1 (9-1-1 complex)/FEN1/DNA assemblies.
21978893 The HUS1 is loaded to damaged sites where it serves as a platform for the selective recruitment of checkpoint and repair proteins.
20545769 The HUS1 protein interacts with casein kinase 2.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20188637 9-1-1 complex is a component of the mismatch repair involved in MNNG-induced damage response.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19615952 Rad9-Rad1-Hus1 complex enhances in vitro activity of 8-oxoguanine DNA glycosylase.
19535328 The interdomain connecting loops (IDC loop) of hRad9, hHus1, and hRad1 are largely divergent and unique structural features of the 9-1-1 complex that are proposed to contribute to DNA damage recognition.
19523882 The DNA binding domain (DBD) within the hLigI catalytic fragment interacts with both PCNA and the heterotrimeric cell-cycle checkpoint clamp, hRad9-hRad1-hHus1 (9-1-1).
19193627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18950845 Observational study of gene-disease association. (HuGE Navigator)
18794804 Loss of HUS1 sensitizes cells to etopside-induced apoptosis by regulating BH3-only proteins.
18676680 Observational study of gene-disease association. (HuGE Navigator)
18156970 Hus1 levels correlated significantly with the clinicopathologic factors of bad prognosis in epithelial ovarian tumors
17855402 Human thymine DNA glycosylase activity is significantly stimulated by hHus1, hRad1, hRad9 separately, and by the 9-1-1 complex.
17583730 Jab1 physically associates with the 9-1-1 complex (Rad1-Rad9-Hus1)
17493829 we report successful tri-cistronic cloning, overexpression and purification of a three-protein complex of Rad9, Rad1 and Hus1 using a single hexa-histidine tag.
17395641 Human NEIL1 DNA glycosylase activity is significantly stimulated by Hus1 and by the Rad9/Rad1/Hus1 heterotrimer.
16814252 These data provide in vivo evidence that the human 9-1-1 complex participates in DNA repair in addition to its previously described role in DNA damage sensing.
16731526 human DNA ligase I is stimulated by the Rad9-rad1-Hus1 checkpoint complex
16216273 PCNA and the Rad9/Rad1/Hus1 complex can independently bind and activate Fen1; acetylation of Fen1 by p300-HAT abolished the stimulatory effect of the complex but not that of PCNA, suggesting a possible mechanism of regulation of this repair pathway
15871698 The long-patch base excision machinery is an important target of the Rad9-Rad1-Hus1 complex, thus enhancing the quality control of DNA.
15556996 complex with rad1 and rad9 is a damage-specific activator of flap endonuclease 1
15314187 The human Rad9/Rad1/Hus1 complex interacts with and stimulates DNA polymerase beta activity.
15122316 HUS1 is an unstable protein that is actively degraded via the ubiquitin-proteasome pathway. Its expression can be stabilized by treating cells with proteasome-specific inhibitors.
12228248 Rad9, Hus1, and Rad1 heterotrimeric complex chromatin binding is a proximal event in the checkpoint signaling cascade
11920544 downregulation by specific antisense oligonucleotides sensitizes human lung carcinoma cells to treatment with the DNA-damaging agent cisplatin
9524127 Functional study of the yeast homolog.

AA Sequence

MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQME      1 - 70
GVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPR     71 - 140
KLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCVTTHFKDLGN    141 - 210
PPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS    211 - 280
//

Text Mined References (61)

PMID Year Title
26600172 2015 The Roles of p21(Waf1/CIP1) and Hus1 in Generation and Transmission of Damage Signals Stimulated by Low-Dose Alpha-Particle Irradiation.
26377631 2015 Distinct functional consequences of MUTYH variants associated with colorectal cancer: Damaged DNA affinity, glycosylase activity and interaction with PCNA and Hus1.
26088138 2015 Intramolecular Binding of the Rad9 C Terminus in the Checkpoint Clamp Rad9-Hus1-Rad1 Is Closely Linked with Its DNA Binding.
25911100 2015 Genome Protection by the 9-1-1 Complex Subunit HUS1 Requires Clamp Formation, DNA Contacts, and ATR Signaling-independent Effector Functions.
24062075 2013 Expression of cell cycle regulatory factors hus1, gadd45a, rb1, cdkn2a and mre11a correlates with expression of clock gene per2 in human colorectal carcinoma tissue.
22926736 2012 Low penetrance alleles as risk modifiers in familial and sporadic breast cancer.
22586102 2012 Repair complexes of FEN1 endonuclease, DNA, and Rad9-Hus1-Rad1 are distinguished from their PCNA counterparts by functionally important stability.
21978893 2011 9-1-1: PCNA's specialized cousin.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
20545769 2010 Casein kinase 2-dependent phosphorylation of human Rad9 mediates the interaction between human Rad9-Hus1-Rad1 complex and TopBP1.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20188637 2010 Interaction between human mismatch repair recognition proteins and checkpoint sensor Rad9-Rad1-Hus1.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19615952 2009 Repair activities of human 8-oxoguanine DNA glycosylase are stimulated by the interaction with human checkpoint sensor Rad9-Rad1-Hus1 complex.
19535328 2009 Structure and functional implications of the human rad9-hus1-rad1 cell cycle checkpoint complex.
19523882 2009 The DNA binding domain of human DNA ligase I interacts with both nicked DNA and the DNA sliding clamps, PCNA and hRad9-hRad1-hHus1.
19464297 2009 Crystal structure of the human rad9-hus1-rad1 clamp.
19193627 2009 A two-stage genome-wide association study of sporadic amyotrophic lateral sclerosis.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18794804 2008 Loss of Hus1 sensitizes cells to etoposide-induced apoptosis by regulating BH3-only proteins.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18156970 2008 Expression of DNA damage checkpoint protein Hus1 in epithelial ovarian tumors correlates with prognostic markers.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17855402 2007 The human checkpoint sensor Rad9-Rad1-Hus1 interacts with and stimulates DNA repair enzyme TDG glycosylase.
17583730 2007 Jab1 mediates protein degradation of the Rad9-Rad1-Hus1 checkpoint complex.
17493829 2007 Tri-cistronic cloning, overexpression and purification of human Rad9, Rad1, Hus1 protein complex.
17395641 2007 The human checkpoint sensor Rad9-Rad1-Hus1 interacts with and stimulates NEIL1 glycosylase.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16814252 2006 The Rad9 protein enhances survival and promotes DNA repair following exposure to ionizing radiation.
16731526 2006 Mechanism of stimulation of human DNA ligase I by the Rad9-rad1-Hus1 checkpoint complex.
16216273 2005 The two DNA clamps Rad9/Rad1/Hus1 complex and proliferating cell nuclear antigen differentially regulate flap endonuclease 1 activity.
15897895 2005 Interaction and colocalization of Rad9/Rad1/Hus1 checkpoint complex with replication protein A in human cells.
15871698 2005 The human checkpoint sensor and alternative DNA clamp Rad9-Rad1-Hus1 modulates the activity of DNA ligase I, a component of the long-patch base excision repair machinery.
15556996 2004 The human Rad9-Rad1-Hus1 checkpoint complex stimulates flap endonuclease 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15314187 2004 The human Rad9/Rad1/Hus1 damage sensor clamp interacts with DNA polymerase beta and increases its DNA substrate utilisation efficiency: implications for DNA repair.
15122316 2004 Human hRad1 but not hRad9 protects hHus1 from ubiquitin-proteasomal degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14611806 2003 Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.
14500360 2003 Expression of mammalian paralogues of HRAD9 and Mrad9 checkpoint control genes in normal and cancerous testicular tissue.
12853948 2003 The DNA sequence of human chromosome 7.
12791985 2003 Sensing DNA damage through ATRIP recognition of RPA-ssDNA complexes.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12578958 2003 Loading of the human 9-1-1 checkpoint complex onto DNA by the checkpoint clamp loader hRad17-replication factor C complex in vitro.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228248 2002 Genotoxin-induced Rad9-Hus1-Rad1 (9-1-1) chromatin association is an early checkpoint signaling event.
11944979 2002 Identification and characterization of a paralog of human cell cycle checkpoint gene HUS1.
11907025 2002 Structures of the human Rad17-replication factor C and checkpoint Rad 9-1-1 complexes visualized by glycerol spray/low voltage microscopy.
11573955 2001 The J domain of Tpr2 regulates its interaction with the proapoptotic and cell-cycle checkpoint protein, Rad9.
11077446 2000 PCNA interacts with hHus1/hRad9 in response to DNA damage and replication inhibition.
10884395 2000 The human checkpoint protein hRad17 interacts with the PCNA-like proteins hRad1, hHus1, and hRad9.
10852904 2000 Retention of the human Rad9 checkpoint complex in extraction-resistant nuclear complexes after DNA damage.
10846170 2000 HDAC1, a histone deacetylase, forms a complex with Hus1 and Rad9, two G2/M checkpoint Rad proteins.
10777662 2000 Physical interactions among human checkpoint control proteins HUS1p, RAD1p, and RAD9p, and implications for the regulation of cell cycle progression.
10359610 1999 The human G2 checkpoint control protein hRAD9 is a nuclear phosphoprotein that forms complexes with hRAD1 and hHUS1.
9878245 1998 cDNA cloning and gene mapping of human homologs for Schizosaccharomyces pombe rad17, rad1, and hus1 and cloning of homologs from mouse, Caenorhabditis elegans, and Drosophila melanogaster.
9872989 1999 Human homologs of Schizosaccharomyces pombe rad1, hus1, and rad9 form a DNA damage-responsive protein complex.
9828130 1998 Cloning of ARE-containing genes by AU-motif-directed display.
9524127 1998 Hus1p, a conserved fission yeast checkpoint protein, interacts with Rad1p and is phosphorylated in response to DNA damage.