Property Summary

NCBI Gene PubMed Count 60
PubMed Score 67.85
PubTator Score 33.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.7e-04
osteosarcoma 7950 1.2e-03
glioblastoma 5792 4.9e-03
non primary Sjogren syndrome sicca 891 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Liver Cirrhosis 181 0.0 1.2

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.100 4.9e-03
non primary Sjogren syndrome sicca -1.200 3.2e-02
osteosarcoma -1.154 1.2e-03
ovarian cancer 1.100 5.7e-04

Protein-protein Interaction (4)

Gene RIF (36)

AA Sequence

MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQENFFNEFQME      1 - 70
GVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPR     71 - 140
KLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHLVIEANLDGELNLKIETELVCVTTHFKDLGN    141 - 210
PPLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS    211 - 280
//

Text Mined References (62)

PMID Year Title