Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 24.42
PubTator Score 14.78

Knowledge Summary

Patent (9,281)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma -1.300 1.0e-06
group 3 medulloblastoma 1.400 1.8e-02
intraductal papillary-mucinous adenoma (... -1.300 3.6e-04
intraductal papillary-mucinous carcinoma... -1.400 1.6e-04
osteosarcoma 2.063 2.7e-04

Gene RIF (7)

AA Sequence

MPAAAGDGLLGEPAAPGGGGGAEDAARPAAACEGSFLPAWVSGVPRERLRDFQHHKRVGNYLIGSRKLGE      1 - 70
GSFAKVREGLHVLTGEKVAIKVIDKKRAKKDTYVTKNLRREGQIQQMIRHPNITQLLDILETENSYYLVM     71 - 140
ELCPGGNLMHKIYEKKRLEESEARRYIRQLISAVEHLHRAGVVHRDLKIENLLLDEDNNIKLIDFGLSNC    141 - 210
AGILGYSDPFSTQCGSPAYAAPELLARKKYGPKIDVWSIGVNMYAMLTGTLPFTVEPFSLRALYQKMVDK    211 - 280
EMNPLPTQLSTGAISFLRSLLEPDPVKRPNIQQALANRWLNENYTGKVPCNVTYPNRISLEDLSPSVVLH    281 - 350
MTEKLGYKNSDVINTVLSNRACHILAIYFLLNKKLERYLSGKSDIQDSLCYKTRLYQIEKYRAPKESYEA    351 - 420
SLDTWTRDLEFHAVQDKKPKEQEKRGDFLHRPFSKKLDKNLPSHKQPSGSLMTQIQNTKALLKDRKASKS    421 - 490
SFPDKDSFGCRNIFRKTSDSNCVASSSMEFIPVPPPRTPRIVKKPEPHQPGPGSTGIPHKEDPLMLDMVR    491 - 560
SFESVDRDDHVEVLSPSHHYRILNSPVSLARRNSSERTLSPGLPSGSMSPLHTPLHPTLVSFAHEDKNSP    561 - 630
PKEEGLCCPPPVPSNGPMQPLGSPNCVKSRGRFPMMGIGQMLRKRHQSLQPSADRPLEASLPPLQPLAPV    631 - 700
NLAFDMADGVKTQC                                                            701 - 714
//

Text Mined References (16)

PMID Year Title