Property Summary

NCBI Gene PubMed Count 31
PubMed Score 9.69
PubTator Score 49.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 3.7e-08
fibroadenoma -1.500 1.3e-02
medulloblastoma, large-cell 1.300 1.5e-04
osteosarcoma 1.550 1.7e-04
pancreatic cancer 1.400 9.6e-03
primary pancreatic ductal adenocarcinoma 1.091 2.7e-02

Gene RIF (26)

AA Sequence

MQARALLLAALAALALAREPPAAPCPARCDVSRCPSPRCPGGYVPDLCNCCLVCAASEGEPCGGPLDSPC      1 - 70
GESLECVRGLCRCRWSHAVCGTDGHTYANVCALQAASRRALQLSGTPVRQLQKGACPLGLHQLSSPRYKF     71 - 140
NFIADVVEKIAPAVVHIELFLRHPLFGRNVPLSSGSGFIMSEAGLIITNAHVVSSNSAAPGRQQLKVQLQ    141 - 210
NGDSYEATIKDIDKKSDIATIKIHPKKKLPVLLLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRE    211 - 280
GRELGLRDSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDRITRFLTEFQDKQIK    281 - 350
DWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSS    351 - 420
ELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM                                         421 - 453
//

Text Mined References (32)

PMID Year Title