Property Summary

NCBI Gene PubMed Count 54
PubMed Score 13379.57
PubTator Score 44.98

Knowledge Summary

Patent (47,431)

TINX Plot

  Disease Sources (4)

Disease Target Count
Major Depressive Disorder 106
Disease Target Count P-value
psoriasis 6685 9.45473244948294E-64
malignant mesothelioma 3163 3.6401122910719E-4
facioscapulohumeral dystrophy 286 0.00511345610689683

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
psoriasis 2.100 0.000
facioscapulohumeral dystrophy 1.800 0.005

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (9)

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (40)

PMID Text
27016479 PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells
26797415 Placental expression of HTR7 was significantly increased in women with pre-eclampsia compared to controls.
26609891 Study shows that HTR7 variants are not related to the overall improvement in schizophrenia symptoms following perospirone or aripiprazole treatment
25706089 Study demonstrated that binding of clozapine or olanzapine to the 5-HT7 receptor leads to antagonist-mediated lysosomal degradation by exposing key residues in the C-terminal tail that interact with GASP-1
25228519 This is a review of literature about how 5-HT7 receptor has been implicated in cognitive disturbances, sleep and circadian rhythmicity disorders, anxiety and depression
25070732 Genetic variations in HTR7 serotonin receptor contribute to the predisposition for alcohol dependence.
24935787 There is a cross-reactivity between 5-HT7 and 5-HT1A receptors and in this review they are shown to have a role in depressive disorders.
23355731 Serotonin skews human macrophage polarization through HTR2B and HTR7.
22543085 the expression of 5-HT7 receptors in brain tissues was higher in the epilepsy group compared with the nonepileptic group; the results suggested that 5-HT7 receptors participate in the pathogenesis of temporal lobe epilepsy
22245496 The interaction between RhoBTB3 and the 5-HT7a receptor strongly inhibits proteasomal degradation of the 5-HT7a receptor.
More...

AA Sequence

MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGC      1 - 70
GEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLIVSLALADLSVAVAVMPFVSV     71 - 140
TDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDRYLGITRPLTYPVRQNGKCMAKMILSVWLLS    141 - 210
ASITLPPLFGWAQNVNDDKVCLISQDFGYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPR    211 - 280
VEPDSVIALNGIVKLQKEVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTAR    281 - 350
PFICGTSCSCIPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK    351 - 420
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD               421 - 479
//

Text Mined References (58)

PMID Year Title
27016479 2016 Serotonin suppresses ?-casein expression via PTP1B activation in human mammary epithelial cells.
26797415 2016 Evaluation of 5-HT7 receptor expression in the placentae of normal and pre-eclamptic women.
26609891 2015 Serotonin 7 Receptor Variants Are Not Associated with Response to Second-Generation Antipsychotics in Japanese Schizophrenia Patients.
25706089 2015 Downregulation of 5-HT7 Serotonin Receptors by the Atypical Antipsychotics Clozapine and Olanzapine. Role of Motifs in the C-Terminal Domain and Interaction with GASP-1.
25228519 2014 [Possible involvement of 5-HT? receptor in pathophysiology of affective disorders and action of antidepressant drugs].
25070732 2014 Association between HTR7 genetic polymorphisms and alcohol dependence, using the alcohol use disorders identification test (AUDIT).
24935787 2014 Interplay between serotonin 5-HT1A and 5-HT7 receptors in depressive disorders.
24736177 2014 Common genetic variants and gene expression associated with white matter microstructure in the human brain.
23355731 2013 Serotonin skews human macrophage polarization through HTR2B and HTR7.
22543085 2012 Involvement of 5-HT? receptors in the pathogenesis of temporal lobe epilepsy.
More...